5LLJ: Integrase

Maedi-Visna virus (MVV) integrase C-terminal domain (residues 220-276). Determined by X-ray diffraction at 1.78 Å resolution. Released 18 Jan 2017.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Maedi visna virus (strain KV1772)
Chains: 2
Atoms: 1,083
Mol. weight: 13.49 kDa
Released: 18 Jan 2017

Explore 5LLJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LLJ contains 4 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	223-226	4	1
β-strand	229-230	2	2
β-strand	233-234	2	2
β-strand	238-242	5	1
β-strand	245-246	2	3
β-strand	250-255	6	3
β-strand	260-265	6	3
α-helix	266-268	3
β-strand	269-272	4	1
α-helix	273-275	3

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	223-226	4	4
β-strand	229-230	2	5
β-strand	233-234	2	5
β-strand	238-242	5	4
β-strand	245-246	2	6
β-strand	250-255	6	6
β-strand	260-265	6	6
α-helix	266-268	3
β-strand	269-271	3	4
α-helix	272-275	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrase	A, B	protein	58	Maedi visna virus (strain KV1772)	P35956

Sequence of entity 1 (A, B), FASTA

>5LLJ_1 Integrase (chains A, B)
EKIRFCYYRTRKRGHPGEWQGPTQVLWGGDGAIVVKDRGTDRYLVIANKDVKFIPPPK

Primary citation

A supramolecular assembly mediates lentiviral DNA integration. Ballandras-Colas, A., Maskell, D.P., Serrao, E. et al. Science (2017) 355:93-95. DOI 10.1126/science.aah7002 · PubMed

Other PDB entries of the same protein (UniProt P35956), best resolution first:

5T3A 2.5 Å, Maedi-Visna virus (MVV) integrase CCD-CTD (residues 60-275)
3HPH 2.64 Å, Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD
9S28 2.8 Å, MVV STC intasome in complex with LEDGF
9S29 2.8 Å, MVV CSC intasome in complex with LEDGF
3HPG 3.28 Å, Visna virus integrase (residues 1-219) in complex with LEDGF IBD: examples of open…
7U32 3.46 Å, MVV cleaved synaptic complex (CSC) intasome at 3.4 A resolution
7Z1Z 3.5 Å, MVV strand transfer complex (STC) intasome in complex with LEDGF/p75 at 3.5 A resolution
7ZPP 4.5 Å, Cryo-EM structure of the MVV CSC intasome at 4.5A resolution
5M0R 8.2 Å, Cryo-EM reconstruction of the maedi-visna virus (MVV) strand transfer complex

Browse structure collections

About this viewer

MolViewer shows 5LLJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.