Structure of human Rab10 in complex with the bMERB domain of Mical-1. Determined by X-ray diffraction at 2.8 Å resolution. Released 24 Aug 2016.
Explore 5LPN in 3D Show helices and sheets RCSB PDB PDBe
5LPN contains 21 α-helices and 15 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-16 | 9 | 1 |
| α-helix | 22-31 | 10 | |
| β-strand | 44-53 | 10 | 1 |
| β-strand | 56-65 | 10 | 1 |
| α-helix | 66 | 1 | |
| α-helix | 69-71 | 3 | |
| α-helix | 72-76 | 5 | |
| α-helix | 79-81 | 3 | |
| β-strand | 84-90 | 7 | 1 |
| α-helix | 94-98 | 5 | |
| α-helix | 100-110 | 11 | |
| β-strand | 116-122 | 7 | 1 |
| α-helix | 134-144 | 11 | |
| β-strand | 147-151 | 5 | 1 |
| β-strand | 152 | 1 | 2 |
| β-strand | 157 | 1 | 2 |
| α-helix | 159-172 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 919-959 | 41 | |
| α-helix | 963-969 | 7 | |
| α-helix | 970-974 | 5 | |
| α-helix | 975-1013 | 39 | |
| α-helix | 1027-1059 | 33 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-15 | 8 | 3 |
| α-helix | 22-31 | 10 | |
| β-strand | 44-51 | 8 | 3 |
| α-helix | 53-55 | 3 | |
| β-strand | 58-65 | 8 | 3 |
| α-helix | 69-72 | 4 | |
| α-helix | 74-79 | 6 | |
| β-strand | 84-90 | 7 | 3 |
| α-helix | 100-110 | 11 | |
| β-strand | 118-122 | 5 | 3 |
| α-helix | 134-144 | 11 | |
| β-strand | 152 | 1 | 4 |
| β-strand | 157 | 1 | 4 |
| α-helix | 159-171 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ras-related protein Rab-10 | A, C | protein | 177 | Homo sapiens | P61026 (AlphaFold model) |
| Protein-methionine sulfoxide oxidase MICAL1 | B | protein | 153 | Homo sapiens | Q8TDZ2 (AlphaFold model) |
>5LPN_1 Ras-related protein Rab-10 (chains A, C) GHMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKI KLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERM LLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTP
>5LPN_2 Protein-methionine sulfoxide oxidase MICAL1 (chains B) GHMKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQSSSPEQQKKLWVGQL LQLVDKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREENLKTAADRQAEDQVL RKLVDLVNQRDALIRFQEERRLSELALGTGAQG
| ID | Name | Formula | Copies |
|---|---|---|---|
| GNP | Phosphoaminophosphonic acid-guanylate ester | C10 H17 N6 O13 P3 | 2 |
| MG | Magnesium ion | Mg | 2 |
bMERB domains are bivalent Rab8 family effectors evolved by gene duplication. Rai, A., Oprisko, A., Campos, J. et al. Elife (2016) 5. DOI 10.7554/eLife.18675 · PubMed
Other PDB entries of the same protein (UniProt P61026 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5LPN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.