Crystal structure of Glycogen Phosphorylase b in complex with KS242. Determined by X-ray diffraction at 1.8 Å resolution. Released 14 Jun 2017.
Explore 5LRD in 3D Show helices and sheets RCSB PDB PDBe
5LRD contains 55 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-16 | 3 | |
| α-helix | 21-33 | 13 | |
| α-helix | 34-38 | 5 | |
| α-helix | 48-77 | 30 | |
| α-helix | 79-80 | 2 | |
| β-strand | 81-85 | 5 | 1 |
| β-strand | 89-92 | 4 | 2 |
| α-helix | 95-102 | 8 | |
| α-helix | 105-114 | 10 | |
| α-helix | 119-123 | 5 | |
| α-helix | 127-128 | 2 | |
| β-strand | 129-131 | 3 | 2 |
| α-helix | 135-149 | 15 | |
| β-strand | 154-159 | 6 | 1 |
| β-strand | 163 | 1 | 3 |
| α-helix | 166 | 1 | |
| β-strand | 167-171 | 5 | 4 |
| β-strand | 174-178 | 5 | 4 |
| β-strand | 191-192 | 2 | 1 |
| α-helix | 194-196 | 3 | |
| β-strand | 198-202 | 5 | 1 |
| β-strand | 205-209 | 5 | 5 |
| β-strand | 212-216 | 5 | 5 |
| β-strand | 219-231 | 13 | 1 |
| β-strand | 238-247 | 10 | 1 |
| α-helix | 262-267 | 6 | |
| α-helix | 270-273 | 4 | |
| α-helix | 274-276 | 3 | |
| β-strand | 278 | 1 | 3 |
| α-helix | 290-312 | 23 | |
| α-helix | 326-328 | 3 | |
| α-helix | 329-332 | 4 | |
| β-strand | 333-338 | 6 | 1 |
| α-helix | 345-351 | 7 | |
| α-helix | 352-356 | 5 | |
| α-helix | 361-371 | 11 | |
| β-strand | 372-375 | 4 | 1 |
| α-helix | 381-383 | 3 | |
| β-strand | 386-388 | 3 | 6 |
| α-helix | 389-395 | 7 | |
| α-helix | 397-417 | 21 | |
| α-helix | 422-428 | 7 | |
| β-strand | 431-432 | 2 | 6 |
| α-helix | 433 | 1 | |
| β-strand | 438-440 | 3 | 6 |
| α-helix | 441-447 | 7 | |
| β-strand | 451-454 | 4 | 1 |
| α-helix | 457-465 | 9 | |
| α-helix | 469-474 | 6 | |
| α-helix | 476-478 | 3 | |
| β-strand | 479-481 | 3 | 1 |
| β-strand | 486 | 1 | 7 |
| α-helix | 488 | 1 | |
| α-helix | 489-494 | 6 | |
| α-helix | 497-507 | 11 | |
| α-helix | 510-513 | 4 | |
| α-helix | 515-524 | 10 | |
| α-helix | 528-553 | 26 | |
| β-strand | 562-567 | 6 | 8 |
| α-helix | 576-592 | 17 | |
| β-strand | 601-606 | 6 | 8 |
| α-helix | 608-610 | 3 | |
| α-helix | 614-630 | 17 | |
| β-strand | 640-645 | 6 | 8 |
| α-helix | 650-659 | 10 | |
| β-strand | 662-665 | 4 | 8 |
| α-helix | 667-668 | 2 | |
| α-helix | 677-683 | 7 | |
| β-strand | 687-690 | 4 | 8 |
| α-helix | 696-703 | 8 | |
| α-helix | 705-707 | 3 | |
| β-strand | 709-710 | 2 | 8 |
| α-helix | 715-724 | 10 | |
| α-helix | 728-734 | 7 | |
| α-helix | 736-747 | 12 | |
| α-helix | 759-767 | 9 | |
| α-helix | 774-776 | 3 | |
| α-helix | 777-791 | 15 | |
| α-helix | 794-806 | 13 | |
| α-helix | 809-811 | 3 | |
| β-strand | 812 | 1 | 7 |
| α-helix | 813-820 | 8 | |
| α-helix | 821-825 | 5 | |
| α-helix | 832-835 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycogen phosphorylase, muscle form | A | protein | 843 | Oryctolagus cuniculus | P00489 (AlphaFold model) |
>5LRD_1 Glycogen phosphorylase, muscle form (chains A) MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKICGGWQMEEA DDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERL DWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF QNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQ ENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVV PRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPA ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVD RLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEE YVKCQERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE KIP
| ID | Name | Formula | Copies |
|---|---|---|---|
| PLP | Pyridoxal-5'-phosphate | C8 H10 N O6 P | 1 |
| KS2 | (2~{R},3~{S},4~{R},5~{R},6~{S})-2-(hydroxymethyl)-6-[5-(4-methylphenyl)-4~{H}-1… | C15 H19 N3 O5 | 1 |
Water and common crystallization additives (DMS) are not listed.
van der Waals interactions govern C-beta-d-glucopyranosyl triazoles' nM inhibitory potency in human liver glycogen phosphorylase. Kantsadi, A.L., Stravodimos, G.A., Kyriakis, E. et al. J Struct Biol (2017) 199:57-67. DOI 10.1016/j.jsb.2017.05.001 · PubMed
Other PDB entries of the same protein (UniProt P00489 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5LRD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.