5LSI: Kinetochore-associated protein DSN1 homolog

Crystal structure of the kinetochore MIS12 complex HEAD2 subdomain containing DSN1 and NSL1 fragments. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Nov 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,288
Mol. weight: 23.9 kDa
Released: 16 Nov 2016

Explore 5LSI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LSI contains 9 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	119-122	4
α-helix	130-149	20
α-helix	150-152	3
α-helix	161-184	24
α-helix	189-192	4

Chain E: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	28-33	6
β-strand	38-40	3	1
α-helix	43-58	16
α-helix	59-63	5
α-helix	69-85	17
β-strand	88-90	3	1
β-strand	93	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinetochore-associated protein DSN1 homolog	D	protein	134	Homo sapiens	Q9H410 (AlphaFold model)
Kinetochore-associated protein NSL1 homolog	E	protein	76	Homo sapiens	Q96IY1 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>5LSI_1 Kinetochore-associated protein DSN1 homolog (chains D)
MSHQERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISV
DLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDG
TLQKCFEDSNGKAS

Sequence of entity 2 (E), FASTA

>5LSI_2 Kinetochore-associated protein NSL1 homolog (chains E)
GPLGSSATPREDFRVRCTSKRAVTEMLQLCGRFVQKLGDALPEEIREPALRDAQWTFESA
VQENISINGQAWQEAS

Primary citation

Structure of the MIS12 Complex and Molecular Basis of Its Interaction with CENP-C at Human Kinetochores. Petrovic, A., Keller, J., Liu, Y. et al. Cell (2016) 167:1028-1040.e15. DOI 10.1016/j.cell.2016.10.005 · PubMed

Other PDB entries of the same protein (UniProt Q9H410 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PPR 3.0 Å, Structure of the human outer kinetochore KMN network complex
5LSJ 3.25 Å, Crystal structure of the human kinetochore MIS12-cenp-C delta-HEAD2 complex
5LSK 3.5 Å, Crystal structure of the human kinetochore MIS12-cenp-C complex
8Q5H 4.5 Å, Human KMN network (outer kinetochore)

Browse structure collections

About this viewer

MolViewer shows 5LSI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.