Structure of the Epigenetic Oncogene MMSET and inhibition by N-Alkyl Sinefungin Derivatives. Determined by X-ray diffraction at 2.14 Å resolution. Released 5 Oct 2016.
Explore 5LSU in 3D Show helices and sheets RCSB PDB PDBe
5LSU contains 29 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 974-981 | 8 | |
| α-helix | 988-990 | 3 | |
| β-strand | 992-993 | 2 | 1 |
| β-strand | 998-999 | 2 | 2 |
| α-helix | 1010-1012 | 3 | |
| α-helix | 1033-1036 | 4 | |
| β-strand | 1039 | 1 | 3 |
| α-helix | 1040-1042 | 3 | |
| α-helix | 1056-1059 | 4 | |
| α-helix | 1062-1064 | 3 | |
| β-strand | 1065-1069 | 5 | 4 |
| β-strand | 1075-1079 | 5 | 4 |
| β-strand | 1083 | 1 | 5 |
| β-strand | 1088-1092 | 5 | 3 |
| β-strand | 1095-1097 | 3 | 2 |
| α-helix | 1099-1111 | 13 | |
| β-strand | 1119-1123 | 5 | 2 |
| β-strand | 1126-1129 | 4 | 2 |
| β-strand | 1133-1134 | 2 | 1 |
| α-helix | 1136-1139 | 4 | |
| α-helix | 1140 | 1 | |
| β-strand | 1141-1142 | 2 | 6 |
| β-strand | 1148-1155 | 8 | 3 |
| β-strand | 1158-1165 | 8 | 3 |
| β-strand | 1169 | 1 | 5 |
| α-helix | 1173 | 1 | |
| β-strand | 1174 | 1 | 4 |
| α-helix | 1175 | 1 | |
| β-strand | 1176-1177 | 2 | 6 |
| α-helix | 1179-1181 | 3 | |
| β-strand | 1183-1184 | 2 | 2 |
| α-helix | 1189 | 1 | |
| β-strand | 1190 | 1 | 7 |
| α-helix | 1191 | 1 | |
| β-strand | 1201 | 1 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 977-981 | 5 | |
| α-helix | 988-990 | 3 | |
| β-strand | 992-993 | 2 | 8 |
| β-strand | 998-999 | 2 | 8 |
| α-helix | 1010-1012 | 3 | |
| α-helix | 1033-1036 | 4 | |
| β-strand | 1039 | 1 | 9 |
| α-helix | 1040-1042 | 3 | |
| α-helix | 1056-1059 | 4 | |
| α-helix | 1062-1064 | 3 | |
| β-strand | 1065-1069 | 5 | 10 |
| β-strand | 1075-1079 | 5 | 10 |
| β-strand | 1083 | 1 | 11 |
| β-strand | 1088-1092 | 5 | 9 |
| β-strand | 1094-1097 | 4 | 8 |
| α-helix | 1099-1111 | 13 | |
| β-strand | 1119-1123 | 5 | 8 |
| β-strand | 1126-1134 | 9 | 8 |
| α-helix | 1136-1139 | 4 | |
| α-helix | 1140 | 1 | |
| β-strand | 1141-1142 | 2 | 12 |
| β-strand | 1148-1155 | 8 | 9 |
| β-strand | 1158-1165 | 8 | 9 |
| β-strand | 1169 | 1 | 11 |
| β-strand | 1174 | 1 | 10 |
| α-helix | 1175 | 1 | |
| β-strand | 1176-1177 | 2 | 12 |
| α-helix | 1179-1181 | 3 | |
| β-strand | 1183 | 1 | 8 |
| α-helix | 1189 | 1 | |
| β-strand | 1190 | 1 | 13 |
| α-helix | 1191 | 1 | |
| β-strand | 1201 | 1 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase NSD2 | A, B | protein | 252 | Homo sapiens | O96028 (AlphaFold model) |
>5LSU_1 Histone-lysine N-methyltransferase NSD2 (chains A, B) MGSSHHHHHHSSGLVPRGSHMKLLRELRETQESERKPPPYKHIKVNKPYGKVQIYTADIS EIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTL QRGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAG PKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVC RCGASNCSGFLG
Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives. Tisi, D., Chiarparin, E., Tamanini, E. et al. ACS Chem Biol (2016) 11:3093-3105. DOI 10.1021/acschembio.6b00308 · PubMed
Other PDB entries of the same protein (UniProt O96028 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5LSU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.