5LTQ: Green fluorescent protein blFP-Y3

Name: PDB 5LTQ: Structure of the Yellow Fluorescent Protein lanYFP from Branchiostoma lanceolatum at pH 7.5
Published: 2016-12-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Structure of the Yellow Fluorescent Protein lanYFP from Branchiostoma lanceolatum at pH 7.5. Determined by X-ray diffraction at 2.05 Å resolution. Released 7 Dec 2016.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Branchiostoma lanceolatum
Chains: 16
Atoms: 28,364
Mol. weight: 485.85 kDa
Released: 7 Dec 2016

Explore 5LTQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LTQ contains 106 α-helices and 215 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	1
β-strand	18-29	12	1
β-strand	34-41	8	1
α-helix	50-53	4
α-helix	62-64	3
α-helix	65-67	3
α-helix	73-79	7
β-strand	84-92	9	1
β-strand	97-107	11	1
β-strand	110-120	11	1
β-strand	133-136	4	1
α-helix	137-138	2
β-strand	139-147	9	1
β-strand	150-161	12	1
β-strand	167-177	11	1
α-helix	180-182	3
α-helix	183-186	4
β-strand	191-201	11	1
β-strand	205-215	11	1

Chain B: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	4
β-strand	18-29	12	4
β-strand	34-41	8	4
α-helix	50-53	4
α-helix	62-64	3
α-helix	65	1
β-strand	66-67	2	5
β-strand	70-71	2	5
α-helix	73-79	7
β-strand	84-92	9	4
β-strand	97-107	11	4
β-strand	110-120	11	4
β-strand	133-136	4	4
α-helix	137-138	2
β-strand	139-147	9	4
β-strand	150-161	12	4
β-strand	166-177	12	4
α-helix	180-182	3
α-helix	183-187	5
β-strand	191-201	11	4
β-strand	205-215	11	4

Chain C: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	6
β-strand	18-29	12	6
β-strand	34-41	8	6
α-helix	50-53	4
α-helix	62-64	3
β-strand	66-67	2	7
β-strand	70-71	2	7
α-helix	73-79	7
β-strand	84-92	9	6
β-strand	97-107	11	6
β-strand	110-120	11	6
β-strand	133-136	4	6
α-helix	137-138	2
β-strand	139-147	9	6
β-strand	150-161	12	6
β-strand	167-177	11	6
α-helix	180-182	3
α-helix	183-186	4
β-strand	191-201	11	6
β-strand	205-215	11	6

Chains D and H: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	2
β-strand	18-29	12	2
β-strand	34-41	8	2
α-helix	50-53	4
α-helix	62-64	3
α-helix	65	1
β-strand	66	1	3
α-helix	67	1
β-strand	71	1	3
α-helix	73-79	7
β-strand	84-92	9	2
β-strand	97-107	11	2
β-strand	110-120	11	2
β-strand	133-136	4	2
α-helix	137-138	2
β-strand	139-147	9	2
β-strand	150-161	12	2
β-strand	167-177	11	2
α-helix	180-182	3
α-helix	183-187	5
β-strand	191-201	11	2
β-strand	205-215	11	2

Chain E: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	8
β-strand	18-29	12	8
β-strand	34-41	8	8
α-helix	50-53	4
α-helix	62-64	3
β-strand	66-67	2	9
β-strand	70-71	2	9
α-helix	73-79	7
β-strand	84-92	9	8
β-strand	97-107	11	8
β-strand	110-120	11	8
β-strand	133-136	4	8
α-helix	137-138	2
β-strand	139-147	9	8
β-strand	150-161	12	8
β-strand	167-177	11	8
α-helix	180-182	3
α-helix	183-187	5
β-strand	191-201	11	8
β-strand	205-215	11	8

Chain F: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	12
β-strand	18-28	11	12
β-strand	35-41	7	12
α-helix	50-53	4
α-helix	62-64	3
α-helix	65	1
β-strand	66-67	2	13
β-strand	70-71	2	13
α-helix	73-79	7
β-strand	84-92	9	12
β-strand	97-107	11	12
β-strand	110-120	11	12
β-strand	133-136	4	12
α-helix	137-138	2
β-strand	139-147	9	12
β-strand	150-161	12	12
β-strand	167-177	11	12
α-helix	180-182	3
α-helix	183-186	4
β-strand	191-201	11	12
β-strand	205-215	11	12
α-helix	222-224	3

Chain G: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	14
β-strand	18-29	12	14
β-strand	34-41	8	14
α-helix	50-53	4
α-helix	62-64	3
α-helix	65	1
β-strand	66	1	15
α-helix	67	1
β-strand	71	1	15
α-helix	73-79	7
β-strand	84-92	9	14
β-strand	97-107	11	14
β-strand	110-120	11	14
β-strand	133-136	4	14
α-helix	137-138	2
β-strand	139-147	9	14
β-strand	150-161	12	14
β-strand	166-177	12	14
α-helix	180-182	3
α-helix	183-186	4
β-strand	191-201	11	14
β-strand	205-215	11	14

Chain I: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	16
β-strand	18-29	12	16
β-strand	34-41	8	16
α-helix	50-53	4
α-helix	65	1
β-strand	66-67	2	17
β-strand	70-71	2	17
α-helix	73-79	7
β-strand	84-92	9	16
β-strand	97-107	11	16
β-strand	110-120	11	16
β-strand	133-136	4	16
β-strand	139-147	9	16
β-strand	150-161	12	16
β-strand	166-177	12	16
α-helix	180-182	3
α-helix	183-187	5
β-strand	191-201	11	16
β-strand	205-215	11	16

7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Green fluorescent protein blFP-Y3	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P	protein	267	Branchiostoma lanceolatum	B1PNC0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P), FASTA

>5LTQ_1 Green fluorescent protein blFP-Y3 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P)
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPMVSKGEEDNMASLPATHELHIFGSFNG
VDFDMVGRGTGNPNDGYEELNLKSTKGALQFSPWILVPQIGYGFHQYLPFPDGMSPFQAA
MKDGSGYQVHRTMQFEDGASLTSNYRYTYEGSHIKGEFQVIGTGFPADGPVMTNSLTAAD
WCVTKMLYPNDKTIISTFDWTYTTGSGKRYQSTARTTYTFAKPMAANILKNQPMFVFRKT
ELKHSKTELNFKEWQKAFTDVMGMDELYK

Primary citation

Structural analysis of the bright monomeric yellow-green fluorescent protein mNeonGreen obtained by directed evolution. Clavel, D., Gotthard, G., von Stetten, D. et al. Acta Crystallogr D Struct Biol (2016) 72:1298-1307. DOI 10.1107/S2059798316018623 · PubMed

Other PDB entries of the same protein (UniProt B1PNC0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LTR 1.21 Å, Structure of the Yellow-Green Fluorescent Protein mNeonGreen from Branchiostoma…

Browse structure collections

About this viewer

MolViewer shows 5LTQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.