5LVZ: KLTH0G14146p

Crystal structure of yeast 14-3-3 protein from Lachancea thermotolerans. Determined by X-ray diffraction at 1.95 Å resolution. Released 19 Oct 2016.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)
Chains: 1
Atoms: 1,959
Mol. weight: 28.6 kDa
Released: 19 Oct 2016

Explore 5LVZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LVZ contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	5-17	13
α-helix	21-32	12
α-helix	37-39	3
α-helix	40-72	33
α-helix	79-105	27
α-helix	106-110	5
α-helix	111-113	3
α-helix	117-137	21
α-helix	140-164	25
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-207	18
α-helix	208-210	3
α-helix	213-236	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KLTH0G14146p	A	protein	253	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN49 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5LVZ_1 KLTH0G14146p (chains A)
MSQSREDSVYLAKLAEQAERYEEMVDSMKAVASSGQELSVEERNLLSVAYKNVIGARRAS
WRIVSSIEQKEEAKDKSEHQVKLIRDYRSKIETELTKICDDILSVLDTHLIPSATTGESK
VFYYKMKGDYHRYLAEFSSGEVRDKATNASLEAYKTASEIATTELPPTHPIRLGLALNFS
VFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSEA
GQDEQQPAEGAQE

Primary citation

Crystal structures of a yeast 14-3-3 protein from Lachancea thermotolerans in the unliganded form and bound to a human lipid kinase PI4KB-derived peptide reveal high evolutionary conservation. Eisenreichova, A., Klima, M., Boura, E. Acta Crystallogr F Struct Biol Commun (2016) 72:799-803. DOI 10.1107/S2053230X16015053 · PubMed

Other PDB entries of the same protein (UniProt C5DN49 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LX2 2.58 Å, Lt 14-3-3 in complex with PI4KIIIB peptide

Browse structure collections

About this viewer

MolViewer shows 5LVZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.