Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571 inhibitor, MgADP form. Determined by X-ray diffraction at 2.67 Å resolution. Released 16 Nov 2016.
Explore 5M05 in 3D Show helices and sheets RCSB PDB PDBe
5M05 contains 34 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 34-39 | 6 | 1 |
| β-strand | 43-53 | 11 | 1 |
| β-strand | 56-61 | 6 | 1 |
| β-strand | 67-71 | 5 | 1 |
| α-helix | 72-74 | 3 | |
| β-strand | 76 | 1 | 1 |
| α-helix | 77-80 | 4 | |
| α-helix | 81-83 | 3 | |
| β-strand | 88 | 1 | 2 |
| α-helix | 89-91 | 3 | |
| α-helix | 97-109 | 13 | |
| β-strand | 114-116 | 3 | 2 |
| β-strand | 121-124 | 4 | 2 |
| α-helix | 135-141 | 7 | |
| α-helix | 146-148 | 3 | |
| α-helix | 153-167 | 15 | |
| β-strand | 171-176 | 6 | 2 |
| α-helix | 183-197 | 15 | |
| α-helix | 219-235 | 17 | |
| β-strand | 236-237 | 2 | 3 |
| β-strand | 245-246 | 2 | 3 |
| β-strand | 249-256 | 8 | 2 |
| β-strand | 262-270 | 9 | 2 |
| α-helix | 274-277 | 4 | |
| β-strand | 287 | 1 | 3 |
| α-helix | 288-296 | 9 | |
| α-helix | 299-304 | 6 | |
| α-helix | 310-312 | 3 | |
| α-helix | 328-342 | 15 | |
| α-helix | 346-362 | 17 | |
| β-strand | 368-369 | 2 | 4 |
| β-strand | 375 | 1 | 5 |
| β-strand | 376-377 | 2 | 4 |
| α-helix | 382-391 | 10 | |
| α-helix | 395-403 | 9 | |
| β-strand | 407-408 | 2 | 6 |
| β-strand | 413-414 | 2 | 6 |
| α-helix | 416-418 | 3 | |
| β-strand | 419 | 1 | 5 |
| α-helix | 420-450 | 31 | |
| β-strand | 459-465 | 7 | 2 |
| α-helix | 467-469 | 3 | |
| α-helix | 477-506 | 30 | |
| α-helix | 517-521 | 5 | |
| α-helix | 522-529 | 8 | |
| α-helix | 537-545 | 9 | |
| α-helix | 552-563 | 12 | |
| β-strand | 569-570 | 2 | 7 |
| β-strand | 580-585 | 6 | 7 |
| β-strand | 588-593 | 6 | 7 |
| α-helix | 597-602 | 6 | |
| α-helix | 607-614 | 8 | |
| α-helix | 619-624 | 6 | |
| α-helix | 659-675 | 17 | |
| β-strand | 678-685 | 8 | 2 |
| α-helix | 698-707 | 10 | |
| α-helix | 710-718 | 9 | |
| β-strand | 723-726 | 4 | 8 |
| α-helix | 727-734 | 8 | |
| α-helix | 749-758 | 10 | |
| β-strand | 767-769 | 3 | 8 |
| β-strand | 773-776 | 4 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin-11 | A | protein | 800 | Gallus gallus | P10587 (AlphaFold model) |
>5M05_1 Myosin-11 (chains A) MAQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVE LQENGKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLF CVVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESG AGKTENTKKVIQYLAVVASSHKGKRTPASLKVHLFPYGELEKQLLQANPILEAFGNAKTV KNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQ MRNDLLLEGFNNYTFLSNGHVPIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVL QLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGAAVVEKAQTK EQADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQL CINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLAL LDEECWFPKATDTSFVEKLIQEQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTK NMDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVG QLYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQG FPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGV LAHLEEERDLGSDYKDDDDK
| ID | Name | Formula | Copies |
|---|---|---|---|
| 52E | 4-{[(2-chloro-3-fluorobenzyl)carbamoyl](methyl)amino}-3,4-dideoxy-5-O-(isoquino… | C24 H26 Cl F N4 O5 | 1 |
| MG | Magnesium ion | Mg | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
Highly selective inhibition of myosin motors provides the basis of potential therapeutic application. Sirigu, S., Hartman, J.J., Planelles-Herrero, V.J. et al. Proc Natl Acad Sci U S A (2016) 113:E7448-E7455. DOI 10.1073/pnas.1609342113 · PubMed
Other PDB entries of the same protein (UniProt P10587 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5M05 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.