X-ray structure of the mambaquaretin-1, a selective antagonist of the vasopressin type 2 receptor. Determined by X-ray diffraction at 1.06 Å resolution. Released 3 May 2017.
Explore 5M4V in 3D Show helices and sheets RCSB PDB PDBe
5M4V contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-6 | 4 | |
| α-helix | 8-9 | 2 | |
| β-strand | 18-24 | 7 | 1 |
| β-strand | 29-35 | 7 | 1 |
| β-strand | 45 | 1 | 1 |
| α-helix | 48-55 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mambaquaretin-1 | A | protein | 57 | Dendroaspis angusticeps | A0A1Z0YU59 (AlphaFold model) |
>5M4V_1 Mambaquaretin-1 (chains A) RPSFCNLPVKPGPCKAFFSAFYYSQKTNKCHSFTYGGCKGNANRFSTLEKCRRTCVG
| ID | Name | Formula | Copies |
|---|---|---|---|
| PGO | S-1,2-propanediol | C3 H8 O2 | 1 |
Water and common crystallization additives (CL) are not listed.
Green mamba peptide targets type-2 vasopressin receptor against polycystic kidney disease. Ciolek, J., Reinfrank, H., Quinton, L. et al. Proc Natl Acad Sci U S A (2017) 114:7154-7159. DOI 10.1073/pnas.1620454114 · PubMed
Other PDB entries of the same protein (UniProt A0A1Z0YU59 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5M4V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.