Translation initiation factor 4E in complex with (SP)-m2(7,2'O)GppSpG mRNA 5' cap analog (beta-S-ARCA D2). Determined by X-ray diffraction at 1.97 Å resolution. Released 20 Dec 2017.
Explore 5M7W in 3D Show helices and sheets RCSB PDB PDBe
5M7W contains 35 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-49 | 12 | 1 |
| α-helix | 57-59 | 3 | |
| β-strand | 60-68 | 9 | 1 |
| α-helix | 69-78 | 10 | |
| β-strand | 79 | 1 | 2 |
| α-helix | 82-84 | 3 | |
| β-strand | 89-95 | 7 | 1 |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 121-124 | 4 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 162-167 | 6 | 1 |
| α-helix | 173-187 | 15 | |
| β-strand | 196-199 | 4 | 1 |
| α-helix | 200-203 | 4 | |
| β-strand | 215-216 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-49 | 12 | 3 |
| α-helix | 56-59 | 4 | |
| β-strand | 60-68 | 9 | 3 |
| α-helix | 69-78 | 10 | |
| β-strand | 79 | 1 | 4 |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 89-95 | 7 | 3 |
| β-strand | 111-116 | 6 | 3 |
| α-helix | 121 | 1 | |
| α-helix | 122-126 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-156 | 8 | 3 |
| β-strand | 162-167 | 6 | 3 |
| α-helix | 173-187 | 15 | |
| β-strand | 196-199 | 4 | 3 |
| α-helix | 200-203 | 4 | |
| β-strand | 215-216 | 2 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35 | 1 | 4 |
| β-strand | 38-48 | 11 | 5 |
| α-helix | 57-59 | 3 | |
| β-strand | 60-68 | 9 | 5 |
| α-helix | 69-76 | 8 | |
| α-helix | 82-84 | 3 | |
| β-strand | 90-95 | 6 | 5 |
| β-strand | 112-117 | 6 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 5 |
| β-strand | 161-167 | 7 | 5 |
| α-helix | 173-187 | 15 | |
| β-strand | 196-198 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35 | 1 | 2 |
| β-strand | 38-49 | 12 | 6 |
| α-helix | 57-59 | 3 | |
| β-strand | 60-68 | 9 | 6 |
| α-helix | 69-78 | 10 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 89-95 | 7 | 6 |
| β-strand | 111-116 | 6 | 6 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-156 | 8 | 6 |
| β-strand | 162-167 | 6 | 6 |
| α-helix | 173-187 | 15 | |
| β-strand | 196-198 | 3 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Eukaryotic translation initiation factor 4E | A, B, C, D | protein | 190 | Mus musculus | P63073 (AlphaFold model) |
>5M7W_1 Eukaryotic translation initiation factor 4E (chains A, B, C, D) VANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMP GCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSD DVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKS GSTTKNRFVV
| ID | Name | Formula | Copies |
|---|---|---|---|
| WZO | [(2~{R},3~{R},4~{R},5~{R})-5-(2-azanyl-7-methyl-6-oxidanylidene-1~{H}-purin-7-i… | C12 H21 N5 O13 P3 S | 4 |
Water and common crystallization additives (GOL) are not listed.
Translation initiation factor 4E in complex with (SP)-m2(7,2'O)GppSpG mRNA 5' cap analog (beta-S-ARCA D2). Warminski, M., Nowak, E., Kubacka, D. et al. To be published.
Other PDB entries of the same protein (UniProt P63073 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5M7W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.