5MIL: DUTPase family protein

Pirating conserved phage mechanisms promotes promiscuous staphylococcal pathogenicity islands transfer. Determined by X-ray diffraction at 2.1 Å resolution. Released 6 Sept 2017.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Staphylococcus aureus
Chains: 2
Atoms: 2,506
Mol. weight: 46.82 kDa
Ligands: MG, DUP
Released: 6 Sept 2017

Explore 5MIL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MIL contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	7-21	15
α-helix	29-47	19
α-helix	61-81	21
α-helix	86-92	7
α-helix	93-95	3
α-helix	107-118	12
α-helix	122-136	15
α-helix	139-159	21

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	7-21	15
α-helix	29-47	19
α-helix	61-81	21
α-helix	86-92	7
α-helix	93-95	3
α-helix	107-118	12
α-helix	122-136	15
α-helix	139-157	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DUTPase family protein	A, B	protein	202	Staphylococcus aureus	Q4ZDP4

Sequence of entity 1 (A, B), FASTA

>5MIL_1 DUTPase family protein (chains A, B)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMTNTLTIDQLQELLQIQKEFDDRIPT
LNLRDSKIAYVVEFFEWFNTLETFKNWKKKPGKPLDVQLDELADMLAFGLSIANQSGVSL
KTLEKLIPSTLGKVYFNTSSIMKDFMEDFVYFGLGEEDSLSLPLNIAYNLYSIDQLIDAY
KKKMKRNHERQDGTADAGKGYV

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
DUP	2'-deoxyuridine 5'-alpha,beta-imido-triphosphate	C9 H16 N3 O13 P3	2

Primary citation

Pirating conserved phage mechanisms promotes promiscuous staphylococcal pathogenicity island transfer. Bowring, J., Neamah, M.M., Donderis, J. et al. Elife (2017) 6. DOI 10.7554/eLife.26487 · PubMed

Other PDB entries of the same protein (UniProt Q4ZDP4), best resolution first:

6H4B 2.9 Å, A polyamorous repressor: deciphering the evolutionary strategy used by the…

Browse structure collections

About this viewer

MolViewer shows 5MIL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.