Crystal structure of the receptor-binding domain of botulinum neurotoxin A1 (crystal form 2). Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Mar 2018.
Explore 5MK7 in 3D Show helices and sheets RCSB PDB PDBe
5MK7 contains 9 α-helices and 42 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 890-894 | 5 | |
| β-strand | 895-900 | 6 | 1 |
| β-strand | 904-906 | 3 | 2 |
| β-strand | 914-917 | 4 | 2 |
| β-strand | 924-928 | 5 | 1 |
| α-helix | 930-932 | 3 | |
| β-strand | 935-936 | 2 | 3 |
| β-strand | 941-948 | 8 | 2 |
| α-helix | 950-952 | 3 | |
| α-helix | 955-957 | 3 | |
| β-strand | 962-969 | 8 | 1 |
| β-strand | 972-979 | 8 | 1 |
| β-strand | 982-988 | 7 | 1 |
| β-strand | 994-1000 | 7 | 1 |
| β-strand | 1004 | 1 | 4 |
| β-strand | 1015-1021 | 7 | 2 |
| β-strand | 1026-1031 | 6 | 2 |
| β-strand | 1034-1040 | 7 | 2 |
| β-strand | 1047-1048 | 2 | 3 |
| β-strand | 1052-1058 | 7 | 1 |
| β-strand | 1066-1075 | 10 | 2 |
| α-helix | 1081-1090 | 10 | |
| β-strand | 1096 | 1 | 5 |
| β-strand | 1098 | 1 | 6 |
| β-strand | 1104 | 1 | 6 |
| α-helix | 1105 | 1 | |
| β-strand | 1106 | 1 | 7 |
| β-strand | 1111-1115 | 5 | 8 |
| β-strand | 1122-1126 | 5 | 8 |
| β-strand | 1133-1137 | 5 | 8 |
| β-strand | 1142-1145 | 4 | 4 |
| β-strand | 1149-1152 | 4 | 4 |
| α-helix | 1158 | 1 | |
| β-strand | 1159-1166 | 8 | 8 |
| β-strand | 1173 | 1 | 7 |
| β-strand | 1175 | 1 | 5 |
| β-strand | 1179-1186 | 8 | 8 |
| β-strand | 1189-1194 | 6 | 8 |
| β-strand | 1195 | 1 | 9 |
| β-strand | 1204-1205 | 2 | 8 |
| β-strand | 1207-1209 | 3 | 8 |
| α-helix | 1211-1213 | 3 | |
| β-strand | 1218 | 1 | 9 |
| β-strand | 1220-1223 | 4 | 8 |
| β-strand | 1235 | 1 | 10 |
| β-strand | 1237-1240 | 4 | 8 |
| β-strand | 1246-1254 | 9 | 8 |
| β-strand | 1259-1264 | 6 | 8 |
| α-helix | 1265-1269 | 5 | |
| β-strand | 1281 | 1 | 10 |
| β-strand | 1282-1285 | 4 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Botulinum neurotoxin type A | A | protein | 433 | Clostridium botulinum | P0DPI1 (AlphaFold model) |
>5MK7_1 Botulinum neurotoxin type A (chains A) MHHHHHHKNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSK IEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEI IWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISN LGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGD YLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIK KYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVM KSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLGCSWE FIPVDDGWGERPL
High resolution crystal structures of the receptor-binding domain ofClostridium botulinumneurotoxin serotypes A and FA. Davies, J.R., Hackett, G.S., Liu, S.M. et al. PeerJ (2018) 6:e4552-e4552. DOI 10.7717/peerj.4552 · PubMed
Other PDB entries of the same protein (UniProt P0DPI1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5MK7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.