5MKW: Human ZRANB3 HNH domain

Crystal structure of the human ZRANB3 HNH domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,249
Mol. weight: 28.52 kDa
Ligands: ZN
Released: 28 Jun 2017

Explore 5MKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MKW contains 18 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	19	1	1
β-strand	26	1	1
α-helix	27-36	10
α-helix	39-47	9
α-helix	50-53	4
α-helix	56-64	9
α-helix	68-70	3
β-strand	72-76	5	2
α-helix	79-80	2
α-helix	89-91	3
β-strand	92-96	5	2
α-helix	97-118	22

Chain B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	19	1	3
β-strand	26	1	3
α-helix	27-36	10
α-helix	39-47	9
α-helix	50-53	4
α-helix	56-64	9
α-helix	68-70	3
β-strand	72-76	5	4
α-helix	79-80	2
α-helix	89-91	3
β-strand	92-96	5	4
α-helix	97-116	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA annealing helicase and endonuclease ZRANB3	A, B	protein	122	Homo sapiens	Q5FWF4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5MKW_1 DNA annealing helicase and endonuclease ZRANB3 (chains A, B)
SMSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLRDAPKSQRKNLLYATWTSKLPLEQLN
EMIRNPGEGHFWQVDHIKPVYGGGGQCSLDNLQTLCTVCHKERTARQAKERSQVRRQSLA
SK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural insights into the function of ZRANB3 in replication stress response. Sebesta, M., Cooper, C.D.O., Ariza, A. et al. Nat Commun (2017) 8:15847-15847. DOI 10.1038/ncomms15847 · PubMed

Other PDB entries of the same protein (UniProt Q5FWF4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MLO 1.96 Å, Crystal structure of human PCNA in complex with ZRANB3 PIP box peptide
5YD8 2.3 Å, Crystal structure of human PCNA in complex with APIM of human ZRANB3
5MLW 2.45 Å, Crystal structure of human PCNA in complex with ZRANB3 APIM motif peptide

Browse structure collections

About this viewer

MolViewer shows 5MKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.