5MOM: PCNA encoding the hypomorphic mutation S228I

Crystal Structure of PCNA encoding the hypomorphic mutation S228I. Determined by X-ray diffraction at 2.27 Å resolution. Released 25 Jan 2017.

Method: X-ray diffraction
Resolution: 2.27 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,731
Mol. weight: 85.65 kDa
Released: 25 Jan 2017

Explore 5MOM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MOM contains 23 α-helices and 56 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	10-20	11
β-strand	25-31	7	2
β-strand	34-40	7	2
β-strand	46-53	8	2
α-helix	54-56	3
β-strand	59-62	4	1
β-strand	66-71	6	2
α-helix	72-79	8
β-strand	87-92	6	1
β-strand	98-104	7	1
β-strand	110-117	8	1
β-strand	135-140	6	2
α-helix	141-152	12
β-strand	157-163	7	3
β-strand	166-173	8	3
β-strand	176-183	8	3
β-strand	196-199	4	2
β-strand	203-208	6	3
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	2
β-strand	235-241	7	2
β-strand	245-251	7	2
α-helix	252-256	5

Chain B: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	4
α-helix	10-19	10
β-strand	25-31	7	5
β-strand	34-40	7	5
β-strand	47-53	7	5
α-helix	54-56	3
β-strand	59-62	4	4
β-strand	66-71	6	5
α-helix	72-79	8
β-strand	87-92	6	4
β-strand	98-104	7	4
β-strand	110-117	8	4
β-strand	119	1	5
α-helix	127-131	5
β-strand	135-140	6	5
α-helix	141-152	12
β-strand	157-162	6	1
β-strand	166-173	8	1
β-strand	176-183	8	1
β-strand	196-199	4	5
β-strand	203-208	6	1
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	5
β-strand	235-241	7	5
β-strand	245-251	7	5

Chain C: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	3
α-helix	10-19	10
β-strand	25-31	7	6
β-strand	34-40	7	6
β-strand	46-53	8	6
α-helix	54-56	3
β-strand	59-62	4	3
β-strand	66-71	6	6
α-helix	72-79	8
β-strand	87-92	6	3
β-strand	98-104	7	3
β-strand	110-117	8	3
β-strand	119	1	6
α-helix	125-127	3
α-helix	129-131	3
β-strand	135-140	6	6
α-helix	141-152	12
β-strand	157-163	7	4
β-strand	166-173	8	4
β-strand	176-183	8	4
β-strand	196-199	4	6
β-strand	203-208	6	4
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	6
β-strand	235-241	7	6
β-strand	245-251	7	6
α-helix	252-254	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proliferating cell nuclear antigen	A, B, C	protein	258	Homo sapiens	P12004 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5MOM_1 Proliferating cell nuclear antigen (chains A, B, C)
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLIMSADVPLVVEYK
IADMGHLKYYLAPKIEDE

Primary citation

PCNA dependent cellular activities tolerate dramatic perturbations in PCNA client interactions. Wilson, R.H., Biasutto, A.J., Wang, L. et al. DNA Repair (Amst) (2017) 50:22-35. DOI 10.1016/j.dnarep.2016.12.003 · PubMed

Other PDB entries of the same protein (UniProt P12004 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U7B 1.88 Å, Crystal structure of hPCNA bound to residues 331-350 of the flap endonuclease-1 (FEN1)
8F5Q 1.9 Å, Crystal structure of human PCNA in complex with the PIP box of FBH1
9N3L 1.9 Å, Co-crystal structure of PCNA bound to HSP90alpha inhibitor, SNX2112
5E0U 1.93 Å, Human PCNA variant (S228I) complexed with p21 at 1.9 Angstroms
5MLO 1.96 Å, Crystal structure of human PCNA in complex with ZRANB3 PIP box peptide
4RJF 2.01 Å, Crystal structure of the human sliding clamp at 2.0 angstrom resolution
5E0V 2.07 Å, Human PCNA variant (S228I) complexed with FEN1 at 2.1 Angstroms
3VKX 2.1 Å, Structure of PCNA
6HVO 2.1 Å, Crystal structure of human PCNA in complex with three peptides of p12 subunit of human…
4ZTD 2.2 Å, Crystal Structure of Human PCNA in complex with a TRAIP peptide
5YCO 2.2 Å, Complex structure of PCNA with UHRF2
1VYM 2.3 Å, Native human pcna

Browse structure collections

About this viewer

MolViewer shows 5MOM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.