5NCM: Crystal structure Cbk1(NTR)-Mob2 complex

Crystal structure Cbk1(NTR)-Mob2 complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 16 May 2018.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,197
Mol. weight: 40.75 kDa
Ligands: ZN
Released: 16 May 2018

Explore 5NCM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NCM contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	111-114	4
α-helix	116-117	2
α-helix	122-144	23
α-helix	145-147	3
α-helix	178-193	16
α-helix	205-207	3
α-helix	211-232	22
α-helix	234-239	6
α-helix	243-260	18
α-helix	266-268	3
α-helix	272-277	6

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	278-316	39
α-helix	322-344	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CBK1 kinase activator protein MOB2	A	protein	245	Saccharomyces cerevisiae	P43563 (AlphaFold model)
Serine/threonine-protein kinase CBK1	B	protein	105	Saccharomyces cerevisiae	P53894 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5NCM_1 CBK1 kinase activator protein MOB2 (chains A)
GSLRNKHHSPKRHSQTSFPAQKSTPQSQQLTSTTPQSQQQEASERSESQQIMFLSEPFVR
TALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYCTPDACPTMNAGPHT
DYLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQM
FRIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESFEKQG
KIIYN

Sequence of entity 2 (B), FASTA

>5NCM_2 Serine/threonine-protein kinase CBK1 (chains B)
GSASSPVQSGFNNGTISNYMYFERRPDLLTKGTQDKAAAVKLKIENFYQSSVKYAIERNE
RRVELETELTSHNWSEERKSRQLSSLGKKESQFLRLRRTRLSLED

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Ndr/Lats Kinases Bind Specific Mob-Family Coactivators through a Conserved and Modular Interface. Parker, B.W., Gogl, G., Balint, M. et al. Biochemistry (2020). DOI 10.1021/acs.biochem.9b01096 · PubMed

Other PDB entries of the same protein (UniProt P43563 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NCL 3.15 Å, Crystal structure of the Cbk1-Mob2 kinase-coactivator complex with an SSD1 peptide
4LQS 3.3 Å, Crystal structure of the Cbk1-Mob2 kinase-coactivator complex
4LQQ 3.6 Å, Crystal structure of the Cbk1(T743E)-Mob2 kinase-coactivator complex in crystal form B
4LQP 4.5 Å, Crystal structure of the Cbk1(T743E)-Mob2 kinase-coactivator complex, in crystal form A

Browse structure collections

About this viewer

MolViewer shows 5NCM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.