5ND7: Kinesin-like protein KIF20A

Microtubule-bound MKLP2 motor domain in the presence of AMPPNP. Determined by electron microscopy at 7.9 Å resolution. Released 4 Oct 2017.

Method: Electron microscopy
Resolution: 7.9 Å
Organisms: Mus musculus, Bos taurus
Chains: 3
Atoms: 9,140
Mol. weight: 158.41 kDa
Ligands: MG, ANP, GTP, GDP
Released: 4 Oct 2017

Explore 5ND7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ND7 contains 55 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	5
α-helix	11-28	18
β-strand	65-69	5	5
α-helix	72-75	4
α-helix	89-91	3
β-strand	92-94	3	5
α-helix	103-104	2
α-helix	105-109	5
α-helix	111-128	18
β-strand	134-140	7	5
α-helix	145-149	5
α-helix	150-160	11
β-strand	165-172	8	5
α-helix	173-174	2
α-helix	183-194	12
β-strand	200-205	6	5
α-helix	206-215	10
α-helix	224-235	12
α-helix	236-240	5
α-helix	241-243	3
β-strand	248	1	5
α-helix	252-259	8
β-strand	269-272	4	5
β-strand	277	1	6
α-helix	288-293	6
α-helix	310-311	2
β-strand	312-321	10	5
α-helix	325-336	12
α-helix	342	1
β-strand	343	1	5
α-helix	344	1
β-strand	351-356	6	5
β-strand	368	1	6
β-strand	373-381	9	5
α-helix	384-399	16
α-helix	406-409	4
α-helix	416-435	20

Chain B: 21 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	7
α-helix	10-28	19
β-strand	30	1	8
β-strand	36	1	8
α-helix	44-51	6
β-strand	53-55	3	9
β-strand	61-63	3	9
β-strand	65-69	5	7
α-helix	72-79	8
α-helix	89-91	3
β-strand	92-94	3	7
α-helix	105-109	5
α-helix	110-126	17
β-strand	132-140	9	7
α-helix	145-149	5
α-helix	150-160	11
β-strand	165-172	8	7
α-helix	183-197	15
β-strand	200-205	6	7
α-helix	206-215	10
α-helix	224-238	15
α-helix	240-242	3
β-strand	246-248	3	10
α-helix	252-257	6
β-strand	267-268	2	7
β-strand	269-272	4	10
α-helix	289-295	7
β-strand	301	1	10
α-helix	307-309	3
β-strand	312-320	9	10
α-helix	325-338	14
α-helix	340-342	3
β-strand	351-356	6	10
β-strand	374-381	8	10
α-helix	382-384	3
α-helix	385-399	15
α-helix	406-409	4
α-helix	415-436	22

Chain C: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	65-70	6	1
α-helix	75-80	6
β-strand	87-90	4	2
β-strand	94-99	6	2
β-strand	116-121	6	2
β-strand	123-126	4	1
α-helix	132-135	4
α-helix	136-140	5
α-helix	141-149	9
β-strand	153-159	7	1
α-helix	165-169	5
β-strand	171	1	3
β-strand	176	1	3
α-helix	178-189	12
β-strand	298-308	11	1
β-strand	311-314	4	1
β-strand	330-332	3	4
β-strand	338-340	3	4
β-strand	346-347	2	1
α-helix	351-364	14
β-strand	380-389	10	1
β-strand	399-407	9	1
α-helix	425-448	24
α-helix	462-466	5
α-helix	468-471	4
β-strand	476-483	8	1
α-helix	490-500	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF20A	C	protein	501	Mus musculus	P97329 (AlphaFold model)
Tubulin alpha chain	A	protein	451	Bos taurus	P81947 (AlphaFold model)
Tubulin beta-2B chain	B	protein	445	Bos taurus	Q6B856 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>5ND7_1 Kinesin-like protein KIF20A (chains C)
SPILESTAADLRSVVRKDLLSDCSVISASLEDKQALLEDTSEKVKVYLRIRPFLTSELDR
QEDQGCVCIENTETLVLQAPKDSFALKSNERGVGQATHKFTFSQIFGPEVGQVAFFNLTM
KEMVKDVLKGQNWLIYTYGVTNSGKTYTIQGTSKDAGILPQSLALIFNSLQGQLHPTPDL
KPLLSNEVIWLDSKQIRQEEMKKLSLLIGGLQEEELSTSVKKRVHTESRIGASNSFDSGV
AGLSSTSQFTSSSQLDETSQLWAQPDTVPVSVPADIRFSVWISFFEIYNELLYDLLEPPS
HQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKNQSFASTHMNQQSSRSH
SIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKHQKSGERLKEAGNINTSLHTLGRCI
AALRQNQQNRSKQNLIPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHAAKFS
ALASQLVHAPPVHLGIPSLHS

Sequence of entity 2 (A), FASTA

>5ND7_2 Tubulin alpha chain (chains A)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Sequence of entity 3 (B), FASTA

>5ND7_3 Tubulin beta-2B chain (chains B)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
TA1	Taxol	C47 H51 N O14	1

Primary citation

The divergent mitotic kinesin MKLP2 exhibits atypical structure and mechanochemistry. Atherton, J., Yu, I.M., Cook, A. et al. Elife (2017) 6. DOI 10.7554/eLife.27793 · PubMed

Other PDB entries of the same protein (UniProt P97329 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LEF 2.09 Å, Rab6A:Kif20A complex
8BJS 2.73 Å, Apo KIF20A[55-510] crystal structure
8F1A 3.1 Å, Apo KIF20A[1-565] class-1 in complex with a microtubule
8F18 3.2 Å, Apo KIF20A[1-565] class-2 in complex with a microtubule
5ND4 4.4 Å, Microtubule-bound MKLP2 motor domain in the presence of ADP.AlFx
5ND2 5.8 Å, Microtubule-bound MKLP2 motor domain in the presence of ADP
5ND3 6.1 Å, Microtubule-bound MKLP2 motor domain in the with no nucleotide

Browse structure collections

About this viewer

MolViewer shows 5ND7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.