'Porcine (Sus scrofa) Major Histocompatibility Complex, class I, presenting IAYERMCNI. Determined by X-ray diffraction at 1.54 Å resolution. Released 25 Apr 2018.
Explore 5NQ2 in 3D Show helices and sheets RCSB PDB PDBe
5NQ2 contains 15 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-13 | 9 | 1 |
| α-helix | 21 | 1 | |
| β-strand | 22-29 | 8 | 1 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 47-48 | 2 | 1 |
| α-helix | 51-55 | 5 | |
| α-helix | 58-86 | 29 | |
| β-strand | 95-104 | 10 | 1 |
| β-strand | 110-119 | 10 | 1 |
| β-strand | 122-127 | 6 | 1 |
| β-strand | 134-136 | 3 | 1 |
| α-helix | 139-150 | 12 | |
| α-helix | 153-160 | 8 | |
| α-helix | 161-165 | 5 | |
| α-helix | 166-175 | 10 | |
| α-helix | 177-180 | 4 | |
| β-strand | 184 | 1 | 2 |
| α-helix | 185-186 | 2 | |
| β-strand | 187-196 | 10 | 3 |
| β-strand | 199-209 | 11 | 3 |
| β-strand | 210 | 1 | 2 |
| β-strand | 215-220 | 6 | 4 |
| β-strand | 223-224 | 2 | 4 |
| β-strand | 230-231 | 2 | 3 |
| α-helix | 232-234 | 3 | |
| β-strand | 235-236 | 2 | 3 |
| β-strand | 242-250 | 9 | 3 |
| α-helix | 255-257 | 3 | |
| β-strand | 258-263 | 6 | 4 |
| β-strand | 271-273 | 3 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 5 |
| α-helix | 4-5 | 2 | |
| β-strand | 6-11 | 6 | 6 |
| β-strand | 21-30 | 10 | 6 |
| β-strand | 31 | 1 | 5 |
| β-strand | 36-41 | 6 | 7 |
| β-strand | 44-45 | 2 | 7 |
| α-helix | 46-47 | 2 | |
| β-strand | 49-50 | 2 | 6 |
| α-helix | 51-53 | 3 | |
| β-strand | 54-55 | 2 | 6 |
| β-strand | 61-69 | 9 | 6 |
| β-strand | 77-82 | 6 | 7 |
| β-strand | 90-93 | 4 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MHC class I antigen | A | protein | 277 | Sus scrofa | B1A9P6 (AlphaFold model) |
| Beta-2-microglobulin | B | protein | 100 | Sus scrofa | Q07717 (AlphaFold model) |
| Ile-ala-tyr-glu-arg-met-cys-asn-ile | C | protein | 9 | unidentified influenza virus | Q9Q0U8 |
>5NQ2_1 MHC class I antigen (chains A) MGPHSLSYFYTAVSRPDRGEPRFIAVGYVDDTQFVRFDSDAPNPRMEPRAPWIQQEGQDY WDRETQIQRDNAQTFRVNLRTALGYYNQSEAGSHTFQSMYGCYLGPDGLLLRGYSQYGYD SADYIALNEDLRSWTAADTAAQITKRKWEAADEAEQWRSYLQGLCVEGLRRYLEMGKDTL QRAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDG TFQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWDP
>5NQ2_2 Beta-2-microglobulin (chains B) MMVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKD WSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH
>5NQ2_3 ILE-ALA-TYR-GLU-ARG-MET-CYS-ASN-ILE (chains C) IAYERMCNI
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (EDO) are not listed.
Induction of influenza-specific local CD8 T-cells in the respiratory tract after aerosol delivery of vaccine antigen or virus in the Babraham inbred pig. Tungatt, K., Dolton, G., Morgan, S.B. et al. PLoS Pathog (2018) 14:e1007017-e1007017. DOI 10.1371/journal.ppat.1007017 · PubMed
MolViewer shows 5NQ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.