5NXC: LIM Domain Kinase 1

LIM Domain Kinase 1 (LIMK1) In Complex With PF-00477736. Determined by X-ray diffraction at 2.25 Å resolution. Released 24 May 2017.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,208
Mol. weight: 36.41 kDa
Ligands: 9DB
Released: 24 May 2017

Explore 5NXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NXC contains 14 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain L: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	333	1	1
α-helix	336-338	3
β-strand	339-347	9	1
β-strand	351-358	8	1
β-strand	364-370	7	1
α-helix	375-390	16
β-strand	396	1	2
α-helix	397-398	2
β-strand	399-404	6	1
β-strand	409-414	6	1
β-strand	420	1	2
α-helix	421-426	6
α-helix	434-453	20
β-strand	466-468	3	2
β-strand	474-476	3	2
α-helix	518-521	4
α-helix	529-544	16
β-strand	555	1	3
β-strand	561	1	3
α-helix	563-569	7
α-helix	576	1
α-helix	579-586	8
α-helix	591-593	3
α-helix	595-596	2
α-helix	597-613	17
α-helix	619-631	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LIM domain kinase 1	L	protein	310	Homo sapiens	P53667 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>5NXC_1 LIM domain kinase 1 (chains L)
SMPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKV
MRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASG
MAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRY
TVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFL
DRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRG
FWETYRRGES

Ligands and cofactors

ID	Name	Formula	Copies
9DB	(2~{R})-2-azanyl-2-cyclohexyl-~{N}-[2-(1-methylpyrazol-4-yl)-9-oxidanylidene-3,…	C22 H25 N7 O2	1

Primary citation

LIM Domain Kinase (LIMK1) In Complex With PF-00477736. Mathea, S., Salah, E., Pike, A.C.W. et al. To be published.

Other PDB entries of the same protein (UniProt P53667 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3S95 1.65 Å, Crystal structure of the human LIMK1 kinase domain in complex with staurosporine
8AAU 1.74 Å, LIM Domain Kinase 1 (LIMK1) bound to LIMKi3
6WLY 1.9 Å, PAK4 kinase domain in complex with LIMK1 Thr508 substrate peptide
9Z6D 1.94 Å, Crystal structure of LIMK1 mutant D460N bound to small molecule inhibitor cLIMK1i
5HVJ 2.2 Å, Crystal structure of LIMK1 D460N mutant in complex with AMP-PNP
9Z6E 2.26 Å, Crystal structure of apo LIMK1 mutant D460N
5L6W 2.53 Å, Structure Of the LIMK1-ATPgammaS-CFL1 Complex
7ATS 2.8 Å, The LIMK1 Kinase Domain Bound To LIJTF500127
7ATU 2.8 Å, The LIMK1 Kinase Domain Bound To LIJTF500025
7B8W 2.8 Å, Structure of LIMK1 Kinase domain with allosteric inhibitor TH-470
5HVK 3.5 Å, Crystal structure of LIMK1 mutant D460N in complex with full-length cofilin-1

Browse structure collections

About this viewer

MolViewer shows 5NXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.