5O3L: Microtubule-associated protein tau

Paired helical filament in Alzheimer's disease brain. Determined by electron microscopy at 3.4 Å resolution. Released 26 Jul 2017.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 10
Atoms: 5,570
Mol. weight: 79.4 kDa
Released: 26 Jul 2017

Explore 5O3L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5O3L contains 0 α-helices and 100 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I and J: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	307	1	1
β-strand	318	1	2
β-strand	324	1	3
β-strand	333	1	4
β-strand	336-340	5	5
β-strand	350	1	6
β-strand	354	1	7
β-strand	360-361	2	8
β-strand	365-371	7	9
β-strand	374	1	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein tau	A, B, C, D, E, F, G, H, I, J	protein	73	Homo sapiens	P10636 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>5O3L_1 Microtubule-associated protein tau (chains A, B, C, D, E, F, G, H, I, J)
VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPG
GGNKKIETHKLTF

Primary citation

Cryo-EM structures of tau filaments from Alzheimer's disease. Fitzpatrick, A.W.P., Falcon, B., He, S. et al. Nature (2017) 547:185-190. DOI 10.1038/nature23002 · PubMed

Other PDB entries of the same protein (UniProt P10636 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ODG 1.0 Å, SVQIVY, Crystal Structure of a tau protein fragment
8KDX 1.01 Å, Tau-S214 Phosphorylation Inhibits Fyn Kinase Interaction and Increases the Decay Time of…
5K7N 1.1 Å, MicroED structure of tau VQIVYK peptide at 1.1 A resolution
9GG8 1.1 Å, Crystal structure of 14-3-3 sigma dC - C38N in complex with Tau pS214 peptide and…
9GG7 1.24 Å, Crystal structure of 14-3-3 sigma dC - C38N in complex with Tau pS324 peptide and…
5V5C 1.25 Å, VQIINK, Structure of the amyloid-spine from microtubule associated protein tau Repeat 2
6FAU 1.25 Å, Crystal structure of C-terminal modified Tau peptide-hybrid 4.2e-I with 14-3-3sigma
8GCK 1.37 Å, Crystal structure of the human CHIP-TPR domain in complex with a 6mer acetylated tau…
4Y5I 1.4 Å, Crystal structure of C-terminal modified Tau peptide-hybrid 126B with 14-3-3sigma
6FAV 1.4 Å, Crystal structure of C-terminal modified Tau peptide-hybrid 4.2f-I with 14-3-3sigma
6FAW 1.4 Å, Crystal structure of C-terminal modified Tau peptide-hybrid 4.2c-I with 14-3-3sigma
9GHK 1.42 Å, Crystal structure of Fyn SH3 domain/tau 214-220 peptide complex

Browse more

5O3L is part of these collections:

Protein folding, misfolding and amyloid

About this viewer

MolViewer shows 5O3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.