5O90: P38alpha T185G mutant

Crystal structure of a P38alpha T185G mutant in complex with TAB1 peptide. Determined by X-ray diffraction at 2.49 Å resolution. Released 31 Jan 2018.

Method: X-ray diffraction
Resolution: 2.49 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 2,599
Mol. weight: 44.74 kDa
Ligands: SB4
Released: 31 Jan 2018

Explore 5O90 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5O90 contains 22 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	8-12	5	1
β-strand	17-21	5	1
β-strand	24-33	10	2
β-strand	36-43	8	2
β-strand	49-55	7	2
α-helix	62-77	16
β-strand	80	1	3
β-strand	83	1	3
β-strand	88-90	3	2
α-helix	96-98	3
β-strand	103-107	5	2
β-strand	111-112	2	3
α-helix	113-117	5
α-helix	124-142	19
α-helix	153-155	3
β-strand	156-158	3	3
β-strand	164-166	3	3
α-helix	184-188	5
α-helix	191-194	4
α-helix	204-218	15
α-helix	228-239	12
α-helix	265-268	4
α-helix	270-272	3
α-helix	279-288	10
α-helix	293-295	3
α-helix	297-298	2
α-helix	299-304	6
α-helix	306-308	3
α-helix	314-316	3
α-helix	320-322	3
α-helix	326-329	4
α-helix	334-346	13
α-helix	350-352	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase 14	A	protein	360	Mus musculus	P47811 (AlphaFold model)
TGF-beta-activated kinase 1 and MAP3K7-binding protein 1	B	protein	29	Homo sapiens	Q15750 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5O90_1 Mitogen-activated protein kinase 14 (chains A)
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVAGRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Sequence of entity 2 (B), FASTA

>5O90_2 TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (chains B)
RVYPVSVPYSSAQSTSKTSVTLSLVMPSQ

Ligands and cofactors

ID	Name	Formula	Copies
SB4	4-(4-fluorophenyl)-1-(4-piperidinyl)-5-(2-amino-4-pyrimidinyl)-imidazole	C18 H19 F N6	1

Primary citation

TAB1-Induced Autoactivation of p38 alpha Mitogen-Activated Protein Kinase Is Crucially Dependent on Threonine 185. Thapa, D., Nichols, C., Bassi, R. et al. Mol Cell Biol (2018) 38. DOI 10.1128/MCB.00409-17 · PubMed

Other PDB entries of the same protein (UniProt P47811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SP9 1.22 Å, Fragment KCL802 in complex with MAP kinase p38-alpha
6Y80 1.24 Å, Fragment KCL_916 in complex with MAP kinase p38-alpha
6SOV 1.31 Å, Fragments KCL_615 and KCL_802 in complex with MAP kinase p38-alpha
6YCW 1.34 Å, Fragment KCL_K767 in complex with MAP kinase p38-alpha
6Y7Z 1.35 Å, Fragment KCL_914 in complex with MAP kinase p38-alpha
6YCU 1.35 Å, Fragment KCL_K777 in complex with MAP kinase p38-alpha
6Y8H 1.37 Å, Novel p38-alpha crystal lattice with highly exposed p38/TAB1 non-canonical PPI surface.
6SPL 1.38 Å, Fragment KCL615 in complex with MAP kinase p38-alpha
6Y7W 1.39 Å, Fragment KCL_1337 in complex with MAP kinase p38-alpha
5R97 1.44 Å, PanDDA analysis group deposition Form1 MAP kinase p38-alpha -- Fragment N13662a in…
6Y82 1.44 Å, Fragment KCL_804 in complex with MAP kinase p38-alpha
5R94 1.45 Å, PanDDA analysis group deposition Form1 MAP kinase p38-alpha -- Fragment KCL081 in…

Browse structure collections

About this viewer

MolViewer shows 5O90 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.