Human Rab32:GDP in complex with Salmonella GtgE C45A mutant. Determined by X-ray diffraction at 2.9 Å resolution. Released 10 Jan 2018.
Explore 5OED in 3D Show helices and sheets RCSB PDB PDBe
5OED contains 15 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 24-25 | 2 | 1 |
| β-strand | 34 | 1 | 2 |
| β-strand | 41 | 1 | 2 |
| α-helix | 45-54 | 10 | |
| α-helix | 64-67 | 4 | |
| β-strand | 81-82 | 2 | 1 |
| α-helix | 83-92 | 10 | |
| β-strand | 95-97 | 3 | 1 |
| α-helix | 98-100 | 3 | |
| α-helix | 102-113 | 12 | |
| α-helix | 118-134 | 17 | |
| β-strand | 138-143 | 6 | 1 |
| β-strand | 150-159 | 10 | 1 |
| β-strand | 164-168 | 5 | 1 |
| β-strand | 176-179 | 4 | 1 |
| α-helix | 180-191 | 12 | |
| β-strand | 204-208 | 5 | 1 |
| α-helix | 213-215 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-32 | 11 | 3 |
| α-helix | 38-47 | 10 | |
| β-strand | 57-58 | 2 | 1 |
| β-strand | 63-67 | 5 | 3 |
| β-strand | 73-81 | 9 | 3 |
| α-helix | 83-87 | 5 | |
| α-helix | 93-96 | 4 | |
| β-strand | 101-107 | 7 | 3 |
| α-helix | 111-127 | 17 | |
| α-helix | 134-137 | 4 | |
| β-strand | 138-143 | 6 | 3 |
| α-helix | 161-165 | 5 | |
| β-strand | 169-172 | 4 | 3 |
| α-helix | 181-194 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GtgE | A | protein | 230 | Salmonella choleraesuis | Q6EAT3 (AlphaFold model) |
| Ras-related protein Rab-32 | B | protein | 183 | Homo sapiens | Q13637 (AlphaFold model) |
>5OED_1 GtgE (chains A) GHMLRHIQNSLGSVYRSNTATPQGQIIHHRNFQSQFDTTGNTLYNNAWVCSLNVIKSRDG NNYSALEDITSDNQAFNNILEGIDIIECENLLKEMNVQKIPESSLFTNIKEALQAEVFNS TVEDDFESFISYELQNHGPLMLIRPSLGSECLHAECIVGYDSEVKKVLIYDSMNTSPEWQ SNIDVYDKLTLAFNDKYKNEDCSICGLYYDGVYEPKPLHSSSWKDWCTIL
>5OED_2 Ras-related protein Rab-32 (chains B) METREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQ LWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPA VLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQS FPN
The protease GtgE from Salmonella exclusively targets inactive Rab GTPases. Wachtel, R., Brauning, B., Mader, S.L. et al. Nat Commun (2018) 9:44-44. DOI 10.1038/s41467-017-02110-1 · PubMed
Other PDB entries of the same protein (UniProt Q6EAT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5OED directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.