Translation initiation factor 4E in complex with m7G(5'S)ppp(5'S)G mRNA 5' cap analog. Determined by X-ray diffraction at 1.92 Å resolution. Released 2 May 2018.
Explore 5OSX in 3D Show helices and sheets RCSB PDB PDBe
5OSX contains 34 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-48 | 11 | 1 |
| α-helix | 57-59 | 3 | |
| β-strand | 60-68 | 9 | 1 |
| α-helix | 69-78 | 10 | |
| β-strand | 79 | 1 | 2 |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 90-95 | 6 | 1 |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 121 | 1 | |
| α-helix | 122-126 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 162-167 | 6 | 1 |
| α-helix | 173-186 | 14 | |
| β-strand | 196-199 | 4 | 1 |
| β-strand | 215-216 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-48 | 11 | 3 |
| α-helix | 57-59 | 3 | |
| β-strand | 60-68 | 9 | 3 |
| α-helix | 69-76 | 8 | |
| β-strand | 79 | 1 | 4 |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 90-95 | 6 | 3 |
| β-strand | 111-116 | 6 | 3 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 3 |
| β-strand | 162-167 | 6 | 3 |
| α-helix | 173-186 | 14 | |
| β-strand | 196-199 | 4 | 3 |
| β-strand | 215-216 | 2 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35 | 1 | 4 |
| β-strand | 38-48 | 11 | 5 |
| β-strand | 61-68 | 8 | 5 |
| α-helix | 69-78 | 10 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 90-95 | 6 | 5 |
| β-strand | 113-116 | 4 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 143-148 | 6 | |
| β-strand | 151-155 | 5 | 5 |
| β-strand | 162-166 | 5 | 5 |
| α-helix | 174-186 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35 | 1 | 2 |
| β-strand | 38-47 | 10 | 6 |
| β-strand | 61-68 | 8 | 6 |
| α-helix | 69-76 | 8 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 90-95 | 6 | 6 |
| α-helix | 105-108 | 4 | |
| β-strand | 113-117 | 5 | 6 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 143-148 | 6 | |
| β-strand | 151-155 | 5 | 6 |
| β-strand | 161-166 | 6 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Eukaryotic translation initiation factor 4E | A, B, C, D | protein | 190 | Mus musculus | P63073 (AlphaFold model) |
>5OSX_1 Eukaryotic translation initiation factor 4E (chains A, B, C, D) VANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMP GCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSD DVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKS GSTTKNRFVV
| ID | Name | Formula | Copies |
|---|---|---|---|
| AKW | [(2~{S},3~{S},4~{R},5~{R})-5-(2-azanyl-7-methyl-6-oxidanylidene-3~{H}-purin-7-i… | C21 H30 N10 O16 P3 S2 | 2 |
Water and common crystallization additives (K) are not listed.
5'-Phosphorothiolate Dinucleotide Cap Analogues: Reagents for Messenger RNA Modification and Potent Small-Molecular Inhibitors of Decapping Enzymes. Wojtczak, B.A., Sikorski, P.J., Fac-Dabrowska, K. et al. J Am Chem Soc (2018) 140:5987-5999. DOI 10.1021/jacs.8b02597 · PubMed
Other PDB entries of the same protein (UniProt P63073 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5OSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.