5OV3: RbBP5 beta-propeller domain

Structure of the RbBP5 beta-propeller domain. Determined by X-ray diffraction at 2.45 Å resolution. Released 28 Mar 2018.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Mus musculus
Chains: 3
Atoms: 5,153
Mol. weight: 85.99 kDa
Released: 28 Mar 2018

Explore 5OV3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OV3 contains 12 α-helices and 61 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	20	1	1
β-strand	27-32	6	2
β-strand	38-43	6	2
β-strand	47-52	6	2
β-strand	57-63	7	2
β-strand	71-74	4	3
β-strand	80-84	5	3
β-strand	89-94	6	3
β-strand	100-105	6	3
β-strand	110-115	6	4
β-strand	122-127	6	4
β-strand	133-136	4	4
β-strand	142-144	3	4
α-helix	145-146	2
β-strand	155-159	5	5
β-strand	165-170	6	5
β-strand	174-179	6	5
β-strand	185-190	6	5
α-helix	191-192	2
β-strand	201-206	6	6
β-strand	212-217	6	6
β-strand	222-226	5	6
α-helix	227-233	7
α-helix	239-241	3
β-strand	243-245	3	6
β-strand	256-259	4	7
β-strand	265-270	6	7
β-strand	275-280	6	7
β-strand	286-291	6	7
α-helix	296-297	2
β-strand	298-303	6	1
β-strand	309-314	6	1
β-strand	317-322	6	1
α-helix	333-335	3
β-strand	336-344	9	8

Chain B: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	20-23	4
α-helix	24-26	3
β-strand	27-32	6	9
β-strand	38-43	6	9
β-strand	47-52	6	9
β-strand	57-63	7	9
β-strand	69-74	6	10
β-strand	80-85	6	10
β-strand	89-94	6	10
β-strand	99-105	7	10
β-strand	110-115	6	11
β-strand	122-127	6	11
β-strand	133-136	4	11
β-strand	141	1	11
β-strand	144	1	11
α-helix	145-146	2
β-strand	156-159	4	12
β-strand	165-169	5	12
β-strand	174-179	6	12
β-strand	185-190	6	12
β-strand	192	1	13
β-strand	198	1	13
β-strand	201-206	6	14
β-strand	212-217	6	14
β-strand	222-226	5	14
α-helix	227-233	7
β-strand	237	1	12
α-helix	239-241	3
β-strand	243-245	3	14
β-strand	254-259	6	15
β-strand	265-270	6	15
β-strand	275-280	6	15
β-strand	285-291	7	15
α-helix	296-297	2
β-strand	298-303	6	8
β-strand	309-314	6	8
β-strand	317-326	10	8

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	363-365	3	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoblastoma-binding protein 5	A, B	protein	381	Mus musculus	Q8BX09 (AlphaFold model)
Retinoblastoma-binding protein 5	C	protein	6	Mus musculus	Q8BX09 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5OV3_1 Retinoblastoma-binding protein 5 (chains A, B)
GPNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIA
KIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRD
QNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLK
TDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEP
EPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLL
DVAWHPVRPIIASISSGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDK
SEPKQTGADAAEDEEVDVTSV

Sequence of entity 2 (C), FASTA

>5OV3_2 Retinoblastoma-binding protein 5 (chains C)
EPKQTG

Primary citation

The structure of the RbBP5 beta-propeller domain reveals a surface with potential nucleic acid binding sites. Mittal, A., Hobor, F., Zhang, Y. et al. Nucleic Acids Res (2018) 46:3802-3812. DOI 10.1093/nar/gky199 · PubMed

Other PDB entries of the same protein (UniProt Q8BX09 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XL2 2.4 Å, WDR5 in complex with an RBBP5 peptide recruited to novel site
2XL3 2.7 Å, WDR5 in complex with an RBBP5 peptide and histone H3 peptide

Browse structure collections

About this viewer

MolViewer shows 5OV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.