PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF HUMAN TENASCIN-C in complex with Z1259335913. Determined by X-ray diffraction at 1.56 Å resolution. Released 28 Oct 2020.
Explore 5R5X in 3D Show helices and sheets RCSB PDB PDBe
5R5X contains 11 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1984-1988 | 5 | |
| β-strand | 1996-2001 | 6 | 1 |
| α-helix | 2002-2004 | 3 | |
| β-strand | 2009-2015 | 7 | 1 |
| α-helix | 2018-2020 | 3 | |
| β-strand | 2023-2029 | 7 | 1 |
| α-helix | 2040-2045 | 6 | |
| β-strand | 2047-2048 | 2 | 1 |
| β-strand | 2054-2055 | 2 | 1 |
| α-helix | 2058-2065 | 8 | |
| β-strand | 2070-2078 | 9 | 1 |
| β-strand | 2081-2092 | 12 | 1 |
| α-helix | 2095-2097 | 3 | |
| β-strand | 2101-2108 | 8 | 1 |
| α-helix | 2115-2117 | 3 | |
| α-helix | 2120-2122 | 3 | |
| β-strand | 2123 | 1 | 2 |
| α-helix | 2136-2140 | 5 | |
| β-strand | 2144 | 1 | 2 |
| β-strand | 2152-2153 | 2 | 3 |
| β-strand | 2168-2169 | 2 | 3 |
| α-helix | 2170-2173 | 4 | |
| β-strand | 2181-2188 | 8 | 1 |
| α-helix | 2189-2193 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tenascin C (Hexabrachion), isoform CRA_a | A | protein | 220 | Homo sapiens | P24821 (AlphaFold model) |
>5R5X_1 Tenascin C (Hexabrachion), isoform CRA_a (chains A) SMPFPKDCSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMTSDGGGWIVFLRRKNGRENF YQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAK TRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMG RYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEG
| ID | Name | Formula | Copies |
|---|---|---|---|
| RWV | 1-{1-[(2-methyl-1,3-thiazol-4-yl)methyl]piperidin-4-yl}methanamine | C11 H19 N3 S | 1 |
PanDDA analysis group deposition. Coker, J.A., Bezerra, G.A., von Delft, F. et al. To be published.
Other PDB entries of the same protein (UniProt P24821 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5R5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.