PanDDA analysis group deposition Form1 MAP kinase p38-alpha -- Fragment N09139b in complex with MAP kinase p38-alpha. Determined by X-ray diffraction at 1.48 Å resolution. Released 22 Jul 2020.
Explore 5R8V in 3D Show helices and sheets RCSB PDB PDBe
5R8V contains 23 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-13 | 6 | 1 |
| β-strand | 16-21 | 6 | 1 |
| β-strand | 24-32 | 9 | 2 |
| β-strand | 36-43 | 8 | 2 |
| β-strand | 49-55 | 7 | 2 |
| α-helix | 62-77 | 16 | |
| β-strand | 83 | 1 | 3 |
| β-strand | 88-90 | 3 | 2 |
| α-helix | 96-98 | 3 | |
| β-strand | 103-107 | 5 | 2 |
| α-helix | 108-109 | 2 | |
| β-strand | 112 | 1 | 3 |
| α-helix | 113-119 | 7 | |
| α-helix | 124-143 | 20 | |
| α-helix | 153-155 | 3 | |
| β-strand | 156-158 | 3 | 3 |
| β-strand | 164-166 | 3 | 3 |
| α-helix | 184-187 | 4 | |
| α-helix | 191-194 | 4 | |
| α-helix | 203-218 | 16 | |
| α-helix | 228-239 | 12 | |
| α-helix | 244-249 | 6 | |
| α-helix | 253-259 | 7 | |
| α-helix | 263-264 | 2 | |
| α-helix | 266-268 | 3 | |
| α-helix | 270-273 | 4 | |
| α-helix | 279-288 | 10 | |
| α-helix | 293-295 | 3 | |
| α-helix | 297-298 | 2 | |
| α-helix | 299-303 | 5 | |
| α-helix | 306-308 | 3 | |
| α-helix | 318-322 | 5 | |
| α-helix | 326-329 | 4 | |
| α-helix | 334-346 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mitogen-activated protein kinase 14 | A | protein | 360 | Mus musculus | P47811 (AlphaFold model) |
>5R8V_1 Mitogen-activated protein kinase 14 (chains A) MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Water and common crystallization additives (SO4, DMS, CL) are not listed.
Mining the PDB for Tractable Cases Where X-ray Crystallography Combined with Fragment Screens Can Be Used to Systematically Design Protein-Protein Inhibitors: Two Test Cases Illustrated by IL1 beta-IL1R and p38 alpha-TAB1 Complexes. Nichols, C., Ng, J., Keshu, A. et al. J Med Chem (2020) 63:7559-7568. DOI 10.1021/acs.jmedchem.0c00403 · PubMed
Other PDB entries of the same protein (UniProt P47811 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5R8V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.