XChem group deposition -- Crystal Structure of human ACVR1 in complex with FM010957a. Determined by X-ray diffraction at 1.3 Å resolution. Released 23 Jun 2021.
Explore 5S89 in 3D Show helices and sheets RCSB PDB PDBe
5S89 contains 36 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 209-217 | 9 | 1 |
| β-strand | 220-227 | 8 | 1 |
| β-strand | 230-237 | 8 | 1 |
| α-helix | 238 | 1 | |
| α-helix | 239-241 | 3 | |
| α-helix | 242-254 | 13 | |
| β-strand | 262 | 1 | 2 |
| α-helix | 263-264 | 2 | |
| β-strand | 265-272 | 8 | 1 |
| β-strand | 277-283 | 7 | 1 |
| β-strand | 290 | 1 | 2 |
| α-helix | 291-297 | 7 | |
| β-strand | 300 | 1 | 3 |
| α-helix | 302-320 | 19 | |
| β-strand | 323 | 1 | 4 |
| β-strand | 329 | 1 | 4 |
| β-strand | 332-333 | 2 | 5 |
| α-helix | 339-341 | 3 | |
| β-strand | 342-344 | 3 | 2 |
| β-strand | 350-352 | 3 | 2 |
| β-strand | 359-360 | 2 | 5 |
| α-helix | 379-381 | 3 | |
| α-helix | 384-387 | 4 | |
| α-helix | 396-415 | 20 | |
| β-strand | 418 | 1 | 3 |
| β-strand | 420 | 1 | 6 |
| β-strand | 423 | 1 | 6 |
| α-helix | 425-427 | 3 | |
| α-helix | 441-445 | 5 | |
| α-helix | 446-450 | 5 | |
| α-helix | 459-463 | 5 | |
| α-helix | 465-475 | 11 | |
| α-helix | 482-484 | 3 | |
| α-helix | 486-487 | 2 | |
| α-helix | 488-496 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 209-217 | 9 | 7 |
| β-strand | 220-227 | 8 | 7 |
| β-strand | 230-237 | 8 | 7 |
| α-helix | 239-241 | 3 | |
| α-helix | 242-252 | 11 | |
| α-helix | 255-257 | 3 | |
| β-strand | 262 | 1 | 8 |
| α-helix | 263-264 | 2 | |
| β-strand | 265-273 | 9 | 7 |
| β-strand | 276-284 | 9 | 7 |
| β-strand | 290 | 1 | 8 |
| α-helix | 291-297 | 7 | |
| β-strand | 300 | 1 | 9 |
| α-helix | 302-320 | 19 | |
| β-strand | 323 | 1 | 10 |
| β-strand | 329 | 1 | 10 |
| β-strand | 331-333 | 3 | 11 |
| α-helix | 339-341 | 3 | |
| β-strand | 342-344 | 3 | 8 |
| β-strand | 350-352 | 3 | 8 |
| β-strand | 359-362 | 4 | 11 |
| β-strand | 367-369 | 3 | 11 |
| α-helix | 379-381 | 3 | |
| α-helix | 384-387 | 4 | |
| α-helix | 396-415 | 20 | |
| β-strand | 418 | 1 | 9 |
| β-strand | 420 | 1 | 12 |
| β-strand | 423 | 1 | 12 |
| α-helix | 425-427 | 3 | |
| α-helix | 441-445 | 5 | |
| α-helix | 446-450 | 5 | |
| α-helix | 459-463 | 5 | |
| α-helix | 465-475 | 11 | |
| α-helix | 482-484 | 3 | |
| α-helix | 486-487 | 2 | |
| α-helix | 488-497 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Activin receptor type-1 | A, B | protein | 301 | Homo sapiens | Q04771 (AlphaFold model) |
>5S89_1 Activin receptor type-1 (chains A, B) SMQRTVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLR HENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAH LHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGT KRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPND PSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI D
| ID | Name | Formula | Copies |
|---|---|---|---|
| XKV | (2R)-2-aminobutanamide | C4 H10 N2 O | 1 |
| LU8 | 4-methyl-3-[4-(1-methylpiperidin-4-yl)phenyl]-5-(3,4,5-trimethoxyphenyl)pyridine | C27 H32 N2 O3 | 4 |
Water and common crystallization additives (SO4, DMS, EDO) are not listed.
XChem group deposition. Williams, E.P., Adamson, R.J., Smil, D. et al. To be published.
Other PDB entries of the same protein (UniProt Q04771 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5S89 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.