Domain-swapped dimer of human Dishevelled2 DEP domain: monoclinic crystal form crystallised from dimeric fraction. Determined by X-ray diffraction at 1.88 Å resolution. Released 12 Oct 2016.
Explore 5SUY in 3D Show helices and sheets RCSB PDB PDBe
5SUY contains 12 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 418 | 1 | 1 |
| α-helix | 423-431 | 9 | |
| β-strand | 440-447 | 8 | 2 |
| β-strand | 452 | 1 | 3 |
| β-strand | 453-454 | 2 | 4 |
| α-helix | 455-465 | 11 | |
| β-strand | 467 | 1 | 5 |
| α-helix | 472-484 | 13 | |
| β-strand | 488-490 | 3 | 4 |
| β-strand | 502-505 | 4 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 418 | 1 | 5 |
| α-helix | 423-431 | 9 | |
| β-strand | 440 | 1 | 3 |
| β-strand | 443-452 | 10 | 2 |
| β-strand | 453-454 | 2 | 6 |
| α-helix | 455-465 | 11 | |
| β-strand | 467 | 1 | 1 |
| α-helix | 472-485 | 14 | |
| β-strand | 488-490 | 3 | 6 |
| β-strand | 502-505 | 4 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Segment polarity protein dishevelled homolog DVL-2 | A, B, C, D | protein | 97 | Homo sapiens | O14641 (AlphaFold model) |
>5SUY_1 Segment polarity protein dishevelled homolog DVL-2 (chains A, B, C, D) SSGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERR EARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSG
Wnt Signalosome Assembly by DEP Domain Swapping of Dishevelled. Gammons, M.V., Renko, M., Johnson, C.M. et al. Mol Cell (2016) 64:92-104. DOI 10.1016/j.molcel.2016.08.026 · PubMed
Other PDB entries of the same protein (UniProt O14641 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5SUY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.