5SYO: PDB entry 5SYO

Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with Cytisine. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Oct 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Aplysia californica, Homo sapiens
Chains: 5
Atoms: 8,234
Mol. weight: 131.96 kDa
Ligands: C5E
Released: 12 Oct 2016

Explore 5SYO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5SYO contains 15 α-helices and 79 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	1-13	13
β-strand	24	1	1
β-strand	27	1	1
β-strand	29-44	16	2
β-strand	49-66	18	2
α-helix	69-72	4
β-strand	77-81	5	2
α-helix	82-84	3
β-strand	90-92	3	3
β-strand	95	1	2
β-strand	100-101	2	2
β-strand	106-110	5	2
β-strand	112-117	6	2
β-strand	120-126	7	2
β-strand	138-146	9	3
β-strand	154-158	5	2
β-strand	162	1	3
β-strand	164	1	2
β-strand	175-187	13	3
β-strand	194-205	12	3

Chain B: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	24	1	4
β-strand	27	1	4
β-strand	29-44	16	5
β-strand	49-66	18	5
α-helix	69-72	4
β-strand	77-81	5	5
α-helix	82-84	3
β-strand	90-92	3	6
β-strand	95	1	5
β-strand	100-101	2	5
β-strand	106-110	5	5
β-strand	112-117	6	5
β-strand	120-126	7	5
β-strand	138-146	9	6
β-strand	154-157	4	5
β-strand	162	1	6
β-strand	164	1	5
β-strand	175-187	13	6
β-strand	194-205	12	6

Chain C: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
β-strand	29-44	16	7
β-strand	49-66	18	7
α-helix	69-72	4
β-strand	77-81	5	7
α-helix	82-84	3
β-strand	90-92	3	8
β-strand	95	1	7
β-strand	100-101	2	7
β-strand	106-110	5	7
β-strand	112-117	6	7
β-strand	120-126	7	7
β-strand	138-146	9	8
β-strand	154-157	4	7
β-strand	162	1	8
β-strand	164	1	7
β-strand	174-187	14	8
β-strand	194-206	13	8

Chain D: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
β-strand	29-44	16	9
β-strand	49-66	18	9
α-helix	69-72	4
β-strand	77-81	5	9
α-helix	82-84	3
β-strand	90-92	3	10
β-strand	95	1	9
β-strand	100-101	2	9
β-strand	106-110	5	9
β-strand	112-117	6	9
β-strand	120-126	7	9
β-strand	138-146	9	10
β-strand	154-157	4	9
β-strand	162	1	10
β-strand	164	1	9
β-strand	175-187	13	10
β-strand	194-205	12	10

Chain E: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	-1-14	16
β-strand	29-44	16	11
β-strand	49-66	18	11
α-helix	70-72	3
β-strand	77-81	5	11
α-helix	82-84	3
β-strand	90-92	3	12
β-strand	95	1	11
β-strand	100-101	2	11
β-strand	106-110	5	11
β-strand	112-117	6	11
β-strand	120-126	7	11
β-strand	138-146	9	12
β-strand	154-157	4	11
β-strand	162	1	12
β-strand	164	1	11
β-strand	175-187	13	12
β-strand	194-205	12	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble acetylcholine receptor, Neuronal acetylcholine receptor subunit alpha-3 chimera	A, B, C, D, E	protein	230	Aplysia californica, Homo sapiens	P32297 (AlphaFold model), Q8WSF8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>5SYO_1 Soluble acetylcholine receptor, Neuronal acetylcholine receptor subunit alpha-3 chimera (chains A, B, C, D, E)
DYKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVD
LVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTH
DGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYAS
SKYEILSATQYKHDIKYNCCEEIYPDVVLVVKFRERRAGNGFFRNLFDSR

Ligands and cofactors

ID	Name	Formula	Copies
C5E	(1R,5S)-1,2,3,4,5,6-hexahydro-8H-1,5-METHANOPYRIDO[1,2-A][1,5]DIAZOCIN-8-one	C11 H14 N2 O	2

Primary citation

Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with Cytisine. Bobango, J., Wu, J., Talley, I.T. et al. To be published.

Other PDB entries of the same protein (UniProt P32297 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZK4 1.9 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
5TVC 1.93 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
6PV7 3.34 Å, Human alpha3beta4 nicotinic acetylcholine receptor in complex with nicotine
6PV8 3.87 Å, Human alpha3beta4 nicotinic acetylcholine receptor in complex with AT-1001

Browse structure collections

About this viewer

MolViewer shows 5SYO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.