5SZX: Zta transcription factor

Epstein-Barr virus Zta DNA binding domain homodimer in complex with methylated DNA. Determined by X-ray diffraction at 2.25 Å resolution. Released 1 Mar 2017.

Method: X-ray diffraction
Resolution: 2.25 Å
Organisms: synthetic construct, Epstein-Barr virus
Chains: 4
Atoms: 1,676
Mol. weight: 25.75 kDa
Ligands: PO4
Released: 1 Mar 2017

Explore 5SZX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5SZX contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	176-221	46
α-helix	226	1

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	176-221	46
α-helix	227-230	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-D(TPCPTPTPCPAPTP(5CM)PGPCPTPCPAPGPTPGPCPT)-3')	C	DNA	18	synthetic construct
DNA (5'-D(APAPGPCPAPCPTPGPAPGP(5CM)PGPAPTPGPAPAPG)-3')	D	DNA	18	synthetic construct
Zta transcription factor	A, B	protein	62	Epstein-Barr virus	P03206 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>5SZX_1 DNA (5'-D(*TP*CP*TP*TP*CP*AP*TP*(5CM)P*GP*CP*TP*CP*AP*GP*TP*GP*CP*T)-3') (chains C)
TCTTCATCGCTCAGTGCT

Sequence of entity 2 (D), FASTA

>5SZX_2 DNA (5'-D(*AP*AP*GP*CP*AP*CP*TP*GP*AP*GP*(5CM)P*GP*AP*TP*GP*AP*AP*G)-3') (chains D)
AAGCACTGAGCGATGAAG

Sequence of entity 3 (A, B), FASTA

>5SZX_3 Zta transcription factor (chains A, B)
LEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRT
PD

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Methyl-dependent and spatial-specific DNA recognition by the orthologous transcription factors human AP-1 and Epstein-Barr virus Zta. Hong, S., Wang, D., Horton, J.R. et al. Nucleic Acids Res (2017) 45:2503-2515. DOI 10.1093/nar/gkx057 · PubMed

Other PDB entries of the same protein (UniProt P03206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SPV 1.3 Å, Crystal structure of a peptide-HLA complex
3VFN 1.5 Å, crystal structure of HLA B*3508LPEP151A, HLA mutant Ala151
1ZSD 1.7 Å, Crystal Structure Of HLA-B*3501 Presenting an 11-Mer EBV Antigen EPLPQGQLTAY
3VFO 1.7 Å, crystal structure of HLA B*3508 LPEP157A, HLA mutant Ala157
2AXF 1.8 Å, The Immunogenicity of a Viral Cytotoxic T Cell Epitope is controlled by its MHC-bound…
3VFP 1.85 Å, crystal structure of HLA B*3508 LPEP158G, HLA mutant Gly158
3VFR 1.85 Å, crystal structure of HLA B*3508LPEP-P4Ala, peptide mutant P4-ala
2AXG 2.0 Å, The Immunogenicity of a Viral Cytotoxic T Cell Epitope is controlled by its MHC-bound…
3KWW 2.18 Å, Crystal structure of the 'restriction triad' mutant of HLA B*3508, beta-2-microglobulin…
2C9L 2.25 Å, Structure of the Epstein-Barr virus ZEBRA protein
2AK4 2.5 Å, Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide
7NX5 2.5 Å, Crystal structure of the Epstein-Barr Virus protein ZEBRA (BZLF1, Zta) bound to a…

Browse structure collections

About this viewer

MolViewer shows 5SZX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.