5T3A: Maedi-Visna virus (MVV) integrase CCD-CTD

Maedi-Visna virus (MVV) integrase CCD-CTD (residues 60-275). Determined by X-ray diffraction at 2.5 Å resolution. Released 18 Jan 2017.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Visna/maedi virus
Chains: 1
Atoms: 1,791
Mol. weight: 25.98 kDa
Released: 18 Jan 2017

Explore 5T3A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5T3A contains 10 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	62-70	9	1
β-strand	73-80	8	1
β-strand	86-91	6	1
α-helix	96-110	15
β-strand	114-117	4	1
α-helix	121-124	4
α-helix	126-134	9
β-strand	138-141	4	1
α-helix	147-167	21
α-helix	168-170	3
α-helix	174-183	10
α-helix	184-188	5
α-helix	197-215	19
β-strand	223-226	4	2
β-strand	229-230	2	3
β-strand	233-234	2	3
β-strand	238-242	5	2
β-strand	245-246	2	4
β-strand	250-254	5	4
β-strand	261-265	5	4
α-helix	266-268	3
β-strand	269-272	4	2
α-helix	273-274	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
integrase	A	protein	222	Visna/maedi virus	P35956

Sequence of entity 1 (A), FASTA

>5T3A_1 integrase (chains A)
IDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDN
GPAFVAESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLKNTLEKLIPMFNAFESALA
GTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQSKSKQEKIRFCYYRTRKRGHPGEWQG
PTQVLWGGDGAIVVKDRGTDRYLVIANKDVKFIPPPKEIQKE

Primary citation

A supramolecular assembly mediates lentiviral DNA integration. Ballandras-Colas, A., Maskell, D.P., Serrao, E. et al. Science (2017) 355:93-95. DOI 10.1126/science.aah7002 · PubMed

Other PDB entries of the same protein (UniProt P35956), best resolution first:

5LLJ 1.78 Å, Maedi-Visna virus (MVV) integrase C-terminal domain (residues 220-276)
3HPH 2.64 Å, Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD
9S28 2.8 Å, MVV STC intasome in complex with LEDGF
9S29 2.8 Å, MVV CSC intasome in complex with LEDGF
3HPG 3.28 Å, Visna virus integrase (residues 1-219) in complex with LEDGF IBD: examples of open…
7U32 3.46 Å, MVV cleaved synaptic complex (CSC) intasome at 3.4 A resolution
7Z1Z 3.5 Å, MVV strand transfer complex (STC) intasome in complex with LEDGF/p75 at 3.5 A resolution
7ZPP 4.5 Å, Cryo-EM structure of the MVV CSC intasome at 4.5A resolution
5M0R 8.2 Å, Cryo-EM reconstruction of the maedi-visna virus (MVV) strand transfer complex

Browse structure collections

About this viewer

MolViewer shows 5T3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.