Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance regulator (CFTR) with dTTP. Determined by X-ray diffraction at 1.86 Å resolution. Released 9 May 2018.
Explore 5TF8 in 3D Show helices and sheets RCSB PDB PDBe
5TF8 contains 11 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 390-399 | 10 | 1 |
| β-strand | 441 | 1 | 1 |
| β-strand | 442 | 1 | 2 |
| β-strand | 443-449 | 7 | 1 |
| β-strand | 453-457 | 5 | 2 |
| α-helix | 464-471 | 8 | |
| β-strand | 477-484 | 8 | 1 |
| β-strand | 488-491 | 4 | 2 |
| β-strand | 500-501 | 2 | 3 |
| α-helix | 502-507 | 6 | |
| α-helix | 511-512 | 2 | |
| α-helix | 514-523 | 10 | |
| α-helix | 526-531 | 6 | |
| α-helix | 536-538 | 3 | |
| β-strand | 540-541 | 2 | 3 |
| α-helix | 550-563 | 14 | |
| β-strand | 568-572 | 5 | 2 |
| α-helix | 580-586 | 7 | |
| α-helix | 587-594 | 8 | |
| β-strand | 599-603 | 5 | 2 |
| α-helix | 607-612 | 6 | |
| β-strand | 615-620 | 6 | 2 |
| β-strand | 623-628 | 6 | 2 |
| α-helix | 630-635 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cystic fibrosis transmembrane conductance regulator | A | protein | 229 | Homo sapiens | P13569 (AlphaFold model) |
>5TF8_1 Cystic fibrosis transmembrane conductance regulator (chains A) SLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP SEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKD NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMAN KTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMG
Thermodynamic correction of F508del-CFTR by ligand binding to a remote site in the mutated domain. Wang, C., Aleksandrov, A.A., Yang, Z. et al. To be published.
Other PDB entries of the same protein (UniProt P13569 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TF8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.