5TFF: PDB entry 5TFF

Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance regulator (CFTR) with UTP. Determined by X-ray diffraction at 1.89 Å resolution. Released 9 May 2018.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,877
Mol. weight: 26.03 kDa
Ligands: UTP, MG
Released: 9 May 2018

Explore 5TFF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TFF contains 11 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	392-399	8	1
β-strand	441	1	1
β-strand	442	1	2
β-strand	443-448	6	1
β-strand	453-458	6	2
α-helix	464-471	8
β-strand	477-484	8	1
β-strand	488-491	4	2
β-strand	500-501	2	3
α-helix	502-507	6
α-helix	511-512	2
α-helix	514-523	10
α-helix	526-531	6
α-helix	536-538	3
β-strand	540-541	2	3
α-helix	550-563	14
β-strand	568-572	5	2
α-helix	580-586	7
α-helix	587-594	8
β-strand	599-603	5	2
α-helix	607-612	6
β-strand	615-620	6	2
β-strand	623-628	6	2
α-helix	630-635	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cystic fibrosis transmembrane conductance regulator	A	protein	229	Homo sapiens	P13569 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5TFF_1 Cystic fibrosis transmembrane conductance regulator (chains A)
SLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP
SEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKD
NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMAN
KTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMG

Ligands and cofactors

ID	Name	Formula	Copies
UTP	Uridine 5'-triphosphate	C9 H15 N2 O15 P3	1
MG	Magnesium ion	Mg	1

Primary citation

Thermodynamic correction of F508del-CFTR by ligand binding to a remote site in the mutated domain. Wang, C., Aleksandrov, A.A., Yang, Z. et al. To be published.

Other PDB entries of the same protein (UniProt P13569 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PZE 1.7 Å, Minimal human CFTR first nucleotide binding domain as a head-to-tail dimer
7QI1 1.76 Å, Crystal structure of human 14-3-3 protein beta in complex with CFTR peptide pS753pS768…
2PZG 1.8 Å, Minimal human CFTR first nucleotide binding domain as a monomer
5TFJ 1.85 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
6WBS 1.86 Å, Human CFTR first nucleotide binding domain with dF508/V510D
6HEP 1.86 Å, Crystal structure of human 14-3-3 beta in complex with CFTR R-domain peptide pS753-pS768
5TF8 1.86 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFA 1.87 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFB 1.87 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFD 1.89 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFI 1.89 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFG 1.91 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…

Browse structure collections

About this viewer

MolViewer shows 5TFF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.