5U2J: MORF double PHD finger

MORF double PHD finger (DPF) in complex with histone H3K14bu. Determined by X-ray diffraction at 1.6 Å resolution. Released 12 Apr 2017.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,221
Mol. weight: 28.94 kDa
Ligands: ZN
Released: 12 Apr 2017

Explore 5U2J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5U2J contains 18 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	204-206	3
β-strand	209	1	2
α-helix	226-227	2
β-strand	228-229	2	2
β-strand	236-237	2	2
α-helix	239-242	4
α-helix	246-253	8
β-strand	265	1	3
α-helix	275-277	3
β-strand	279-280	2	3
β-strand	287-288	2	3
α-helix	290-292	3
α-helix	296-297	2
α-helix	300-302	3

Chain B: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	209	1	4
α-helix	226-227	2
β-strand	228-229	2	4
β-strand	236-237	2	4
α-helix	239-242	4
α-helix	246-252	7
β-strand	265	1	1
β-strand	278-280	3	1
β-strand	287-289	3	1
α-helix	290-292	3
α-helix	296-297	2
α-helix	300-301	2

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2	1	3
α-helix	4-11	8
α-helix	13-15	3

Chain D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	1
α-helix	4-11	8
α-helix	13-15	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H3K14bu	C, D	protein	16	Homo sapiens	P68431 (AlphaFold model)
Histone acetyltransferase KAT6B	A, B	protein	111	Homo sapiens	Q8WYB5 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>5U2J_1 Histone H3K14bu (chains C, D)
ARTKQTARKSTGGXAP

Sequence of entity 2 (A, B), FASTA

>5U2J_2 Histone acetyltransferase KAT6B (chains A, B)
MDPIPICSFCLGTKESNREKKPEELLSCADCGSSGHPSCLKFCPELTTNVKALRWQCIEC
KTCSACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPKGMWICQVCRPK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8

Primary citation

Recognition of Histone H3K14 Acylation by MORF. Klein, B.J., Simithy, J., Wang, X. et al. Structure (2017) 25:650-654.e2. DOI 10.1016/j.str.2017.02.003 · PubMed

Other PDB entries of the same protein (UniProt P68431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5SVY 1.05 Å, MORC3 CW in complex with histone H3K4me1
2V89 1.1 Å, Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide at 1.1A resolution
5SZC 1.19 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
5SZB 1.2 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
6BHD 1.25 Å, Crystal structure of SETDB1 with a modified H3 peptide
4UP0 1.28 Å, Ternary crystal structure of the Pygo2 PHD finger in complex with the B9L HD1 domain and…
5WXH 1.3 Å, Crystal structure of TAF3 PHD finger bound to H3K4me3
5FFV 1.3 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone…
4L7X 1.35 Å, Crystal structure of the DIDO PHD finger in complex with H3K4me3
6BHE 1.35 Å, Crystal structure of SETDB1 with a modified H3 peptide
6BHI 1.4 Å, Crystal structure of SETDB1 with a modified H3 peptide
3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail

Browse structure collections

About this viewer

MolViewer shows 5U2J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.