5U5M: Memab trastuzumab, light chain
Crystal structure of I83E meditope-enabled trastuzumab with azido-meditope. Determined by X-ray diffraction at 1.88 Å resolution. Released 14 Mar 2018.
- Method
- X-ray diffraction
- Resolution
- 1.88 Å
- Organisms
- Homo sapiens, Finegoldia magna, Staphylococcus aureus
- Chains
- 5
- Atoms
- 5,221
- Mol. weight
- 62.14 kDa
- Ligands
- MRY
- Released
- 14 Mar 2018
Explore 5U5M in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5U5M contains 25 α-helices and 54 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 9 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-107 | 6 | 2 |
| β-strand | 111 | 1 | 3 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 4 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 4 |
| β-strand | 140 | 1 | 3 |
| β-strand | 145-150 | 6 | 5 |
| β-strand | 153-154 | 2 | 5 |
| α-helix | 155 | 1 | |
| β-strand | 159-163 | 5 | 4 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 4 |
| α-helix | 183-188 | 6 | |
| β-strand | 191-197 | 7 | 5 |
| β-strand | 205-210 | 6 | 5 |
Chain B: 10 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 6 |
| β-strand | 11-12 | 2 | 7 |
| β-strand | 18-25 | 8 | 6 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-40 | 8 | 8 |
| β-strand | 44-52 | 9 | 8 |
| β-strand | 57-60 | 4 | 8 |
| β-strand | 65 | 1 | 6 |
| β-strand | 68-73 | 6 | 6 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 6 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 8 |
| α-helix | 101-103 | 3 | |
| β-strand | 107-110 | 4 | 8 |
| β-strand | 114-116 | 3 | 8 |
| β-strand | 117-118 | 2 | 7 |
| α-helix | 122-123 | 2 | |
| β-strand | 124 | 1 | 9 |
| α-helix | 125-126 | 2 | |
| β-strand | 127-131 | 5 | 10 |
| β-strand | 138-139 | 2 | 10 |
| β-strand | 142-152 | 11 | 10 |
| β-strand | 153 | 1 | 9 |
| β-strand | 158-161 | 4 | 11 |
| α-helix | 162-164 | 3 | |
| β-strand | 166 | 1 | 11 |
| β-strand | 170-172 | 3 | 10 |
| α-helix | 173-175 | 3 | |
| β-strand | 176-177 | 2 | 10 |
| β-strand | 183-192 | 10 | 10 |
| α-helix | 193-195 | 3 | |
| β-strand | 196 | 1 | 12 |
| β-strand | 199 | 1 | 12 |
| β-strand | 202-207 | 6 | 11 |
| α-helix | 208-210 | 3 | |
| β-strand | 212-217 | 6 | 11 |
Chain C: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-16 | 12 | |
| α-helix | 22-34 | 13 | |
| α-helix | 36-38 | 3 | |
| α-helix | 39-52 | 14 | |
Chain D: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-4 | 3 | 13 |
| β-strand | 9-11 | 3 | 13 |
Chain E: 2 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 21-28 | 8 | 2 |
| β-strand | 34-41 | 8 | 2 |
| α-helix | 43-61 | 19 | |
| β-strand | 64-69 | 6 | 2 |
| α-helix | 70-72 | 3 | |
| β-strand | 74-79 | 6 | 2 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Memab trastuzumab, light chain | A | protein | 214 | Homo sapiens | |
| Memab trastuzumab, heavy chain | B | protein | 223 | Homo sapiens | |
| Protein L | E | protein | 63 | Finegoldia magna | Q51918 (AlphaFold model) |
| Immunoglobulin G binding protein A | C | protein | 54 | Staphylococcus aureus | P02976 (AlphaFold model) |
| Azido-PEG4-meditope | D | protein | 13 | synthetic construct | |
Sequence of entity 1 (A), FASTA
>5U5M_1 MEMAB TRASTUZUMAB, LIGHT CHAIN (chains A)
DIQMTQSPILLSASVGDRVTITCRASQDVNTAVAWYQQRTNGSPRLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDEADYYCQQHYTTPPTFGAGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Sequence of entity 2 (B), FASTA
>5U5M_2 MEMAB TRASTUZUMAB, HEAVY CHAIN (chains B)
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQSPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAIYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Sequence of entity 3 (E), FASTA
>5U5M_3 Protein L (chains E)
SEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEYTADLEDGGNHMNIK
FAG
Sequence of entity 4 (C), FASTA
>5U5M_4 Immunoglobulin G binding protein A (chains C)
GSYNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQA
Sequence of entity 5 (D), FASTA
>5U5M_5 AZIDO-PEG4-MEDITOPE (chains D)
XCQFDXSTXRLRC
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MRY | Meso-erythritol | C4 H10 O4 | 1 |
Primary citation
Crystal Structure Of I83E Meditope-Enabled Trastuzumab With Azido-Meditope. Williams, J.C., Bzymek, K.P., Pucket, J. et al. To be published.
Other PDB entries of the same protein (UniProt Q51918 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5U6A 1.74 Å, Crystal structure of I83E meditope-enabled trastuzumab with azido-PEG3-meditope
- 5U3D 1.77 Å, Structure of meditope enabled trastuzumab I83E variant
- 5U5F 1.81 Å, Meditope enabled trastuzumab I83E variant in complex with (ac) CQFDA(PH)2STRRLRCGGSK
- 6B9Z 1.82 Å, Trastuzumab Fab v3
- 6BAH 1.9 Å, Trastuzumab Fab v3 with 5-diphenyl meditope variant
- 4IOI 1.95 Å, Meditope-enabled trastuzumab in complex with CQFDLSTRRLKC
- 4HJG 2.0 Å, Meditope-enabled trastuzumab
- 4HKZ 2.08 Å, Trastuzumab Fab complexed with Protein L and Protein A fragments
- 6B9Y 2.14 Å, Trastuzumab Fab v3 in complex with 5-phenyl meditope variant
- 6BAE 2.14 Å, Trastuzumab Fab v3 in complex with CQFDLSTRRLKC
- 1YMH 2.6 Å, anti-HCV Fab 19D9D6 complexed with protein L (PpL) mutant A66W
- 1HEZ 2.7 Å, Structure of P. magnus protein L bound to a human IgM Fab.
Browse structure collections
About this viewer
MolViewer shows 5U5M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.