5U7M: HIV-1 BG505 SOSIP.664 Prefusion Env Trimer
Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to Small Molecule HIV-1 Entry Inhibitor BMS-378806 in Complex with Human Antibodies PGT122 and 35O22 at 3.8 Angstrom. Determined by X-ray diffraction at 3.02 Å resolution. Released 30 Aug 2017.
- Method
- X-ray diffraction
- Resolution
- 3.02 Å
- Organisms
- Human immunodeficiency virus 1, Homo sapiens
- Chains
- 6
- Atoms
- 12,026
- Mol. weight
- 180.98 kDa
- Ligands
- 83G, NAG
- Released
- 30 Aug 2017
Explore 5U7M in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5U7M contains 46 α-helices and 135 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain B: 7 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 530-533 | 4 | |
| α-helix | 534-536 | 3 | |
| α-helix | 537-542 | 6 | |
| α-helix | 570-594 | 25 | |
| β-strand | 603-609 | 7 | 1 |
| α-helix | 619-622 | 4 | |
| α-helix | 628-634 | 7 | |
| α-helix | 639-661 | 23 | |
Chain D: 5 helices, 24 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 2 |
| β-strand | 10-12 | 3 | 3 |
| β-strand | 18-27 | 10 | 2 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-40 | 7 | 3 |
| β-strand | 44-51 | 8 | 3 |
| β-strand | 57-59 | 3 | 3 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-71 | 5 | 2 |
| β-strand | 72C-72D | 2 | 2 |
| β-strand | 74-82 | 9 | 2 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 3 |
| β-strand | 102-103 | 2 | 3 |
| β-strand | 107-111 | 5 | 3 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 4 |
| β-strand | 120-130 | 11 | 5 |
| β-strand | 135-143 | 9 | 5 |
| β-strand | 145 | 1 | 6 |
| β-strand | 146 | 1 | 4 |
| β-strand | 151-154 | 4 | 7 |
| β-strand | 163-166 | 4 | 5 |
| α-helix | 167 | 1 | |
| β-strand | 176 | 1 | 6 |
| β-strand | 179-182 | 4 | 5 |
| β-strand | 185 | 1 | 5 |
| β-strand | 195-200 | 6 | 7 |
| β-strand | 205-210 | 6 | 7 |
Chain E: 6 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-6 | 2 | 8 |
| β-strand | 9-14 | 5 | 9 |
| β-strand | 20-24 | 5 | 8 |
| β-strand | 32-37 | 6 | 9 |
| β-strand | 45-48 | 4 | 9 |
| α-helix | 53 | 1 | |
| β-strand | 54 | 1 | 9 |
| α-helix | 55 | 1 | |
| β-strand | 62-66 | 5 | 8 |
| β-strand | 70-75 | 6 | 8 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-91 | 7 | 9 |
| β-strand | 97 | 1 | 9 |
| β-strand | 102-106A | 6 | 9 |
| β-strand | 111 | 1 | 10 |
| β-strand | 114-118 | 5 | 11 |
| α-helix | 119-121 | 3 | |
| β-strand | 130-139 | 10 | 11 |
| β-strand | 140 | 1 | 10 |
| β-strand | 145-150 | 6 | 12 |
| β-strand | 154 | 1 | 12 |
| β-strand | 159-161 | 3 | 11 |
| α-helix | 162-164 | 3 | |
| β-strand | 165-166 | 2 | 11 |
| β-strand | 172-180 | 9 | 11 |
| α-helix | 182-185 | 4 | |
| β-strand | 191-197 | 7 | 12 |
| β-strand | 200-206 | 7 | 12 |
Chain G: 15 helices, 45 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 35-40 | 6 | 1 |
| β-strand | 45-47 | 3 | 13 |
| β-strand | 53 | 1 | 14 |
| β-strand | 67 | 1 | 15 |
| α-helix | 75-78 | 4 | |
| β-strand | 83-86 | 4 | 13 |
| β-strand | 91-94 | 4 | 16 |
| α-helix | 99-116 | 18 | |
| β-strand | 121 | 1 | 17 |
| α-helix | 123-125 | 3 | |
| β-strand | 129 | 1 | 18 |
| β-strand | 130 | 1 | 19 |
| β-strand | 133 | 1 | 20 |
| β-strand | 154-155 | 2 | 20 |
| β-strand | 158-160 | 3 | 19 |
| β-strand | 171-173 | 3 | 19 |
| β-strand | 176-177 | 2 | 20 |
| α-helix | 178-180 | 3 | |
| β-strand | 181-183 | 3 | 18 |
| β-strand | 191-193 | 3 | 18 |
| α-helix | 194-197 | 4 | |
| β-strand | 201-203 | 3 | 17 |
| α-helix | 204-205 | 2 | |
| β-strand | 209 | 1 | 15 |
| β-strand | 215 | 1 | 21 |
| β-strand | 218 | 1 | 14 |
| β-strand | 223-228 | 6 | 13 |
| β-strand | 236-239 | 4 | 16 |
| β-strand | 242-245 | 4 | 13 |
| β-strand | 247 | 1 | 14 |
| β-strand | 251 | 1 | 21 |
| β-strand | 259-261 | 3 | 22 |
| α-helix | 264-266 | 3 | |
| α-helix | 270 | 1 | |
| β-strand | 271-274 | 4 | 22 |
| β-strand | 284-298 | 15 | 22 |
| β-strand | 301 | 1 | 23 |
| β-strand | 304-308 | 5 | 24 |
| β-strand | 316-320 | 5 | 24 |
| α-helix | 321A-322 | 2 | |
| β-strand | 323 | 1 | 23 |
| β-strand | 330-334 | 5 | 22 |
| α-helix | 335-349 | 15 | |
| β-strand | 358-361 | 4 | 22 |
| α-helix | 369-372 | 4 | |
| β-strand | 373-379 | 7 | 25 |
| β-strand | 381-386 | 6 | 25 |
| α-helix | 387-389 | 3 | |
| β-strand | 393-395 | 3 | 22 |
| β-strand | 413-417 | 5 | 22 |
| β-strand | 418-421 | 4 | 25 |
| β-strand | 423-425 | 3 | 17 |
| α-helix | 426 | 1 | |
| β-strand | 433-435 | 3 | 17 |
| α-helix | 436-440 | 5 | |
| β-strand | 443-456 | 14 | 22 |
| β-strand | 465-470 | 6 | 22 |
| α-helix | 475-480 | 6 | |
| β-strand | 486-491 | 6 | 13 |
| β-strand | 494-499 | 6 | 1 |
Chain H: 7 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 26 |
| β-strand | 11-12 | 2 | 27 |
| β-strand | 17-25 | 9 | 26 |
| β-strand | 33-38 | 6 | 28 |
| β-strand | 46-51 | 6 | 28 |
| β-strand | 57-59 | 3 | 28 |
| β-strand | 67-72 | 6 | 26 |
| β-strand | 77-82A | 7 | 26 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-90 | 3 | 29 |
| β-strand | 91-100A | 11 | 28 |
| β-strand | 100J-100P | 7 | 28 |
| β-strand | 105-107 | 3 | 29 |
| β-strand | 108-109 | 2 | 27 |
| α-helix | 113-114 | 2 | |
| β-strand | 118-119 | 2 | 30 |
| α-helix | 121 | 1 | |
| β-strand | 122 | 1 | 30 |
| α-helix | 123-124 | 2 | |
| β-strand | 133-143 | 11 | 30 |
| β-strand | 149-152 | 4 | 31 |
| α-helix | 153-155 | 3 | |
| β-strand | 161-163 | 3 | 30 |
| α-helix | 164-166 | 3 | |
| β-strand | 174-183 | 10 | 30 |
| β-strand | 193-198 | 6 | 31 |
| α-helix | 199-201 | 3 | |
| β-strand | 203-208 | 6 | 31 |
Chain L: 6 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-13 | 4 | 32 |
| β-strand | 19-26 | 8 | 33 |
| β-strand | 31 | 1 | 34 |
| β-strand | 34-38 | 5 | 32 |
| β-strand | 44-48 | 5 | 32 |
| β-strand | 49 | 1 | 35 |
| β-strand | 53 | 1 | 35 |
| β-strand | 62-64 | 3 | 33 |
| β-strand | 70-75 | 6 | 33 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-89 | 5 | 32 |
| β-strand | 92 | 1 | 34 |
| β-strand | 97 | 1 | 28 |
| α-helix | 98-100 | 3 | |
| β-strand | 102-106 | 5 | 32 |
| β-strand | 117-119 | 3 | 36 |
| α-helix | 120-122 | 3 | |
| α-helix | 123-126 | 4 | |
| β-strand | 131-138 | 8 | 36 |
| β-strand | 146-151 | 6 | 37 |
| β-strand | 154-155 | 2 | 37 |
| β-strand | 160-162 | 3 | 36 |
| α-helix | 163-165 | 3 | |
| β-strand | 166-167 | 2 | 36 |
| β-strand | 173-181 | 9 | 36 |
| α-helix | 183-186 | 4 | |
| β-strand | 192-197 | 6 | 37 |
| β-strand | 202-207 | 6 | 37 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Envelope glycoprotein gp160 | B | protein | 153 | Human immunodeficiency virus 1 | Q2N0S5 |
| 35O22 FAB heavy chain | D | protein | 243 | Homo sapiens | |
| 35O22 FAB light chain | E | protein | 216 | Homo sapiens | |
| Envelope glycoprotein gp160 | G | protein | 481 | Human immunodeficiency virus 1 | Q2N0S5 |
| PGT122 FAB heavy chain | H | protein | 235 | Homo sapiens | |
| PGT122 FAB light chain | L | protein | 213 | Homo sapiens | |
Sequence of entity 1 (B), FASTA
>5U7M_1 Envelope glycoprotein gp160 (chains B)
AVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVW
GIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQW
DKEISNYTQIIYGLLEESQNQQEKNEQDLLALD
Sequence of entity 2 (D), FASTA
>5U7M_2 35O22 FAB HEAVY CHAIN (chains D)
QGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNL
APAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYL
WGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEV
LFQ
Sequence of entity 3 (E), FASTA
>5U7M_3 35O22 FAB LIGHT CHAIN (chains E)
QSVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGI
SPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Sequence of entity 4 (G), FASTA
>5U7M_4 Envelope glycoprotein gp160 (chains G)
AENLWVTVYYGVPVWKDAETTLFCASDAKAYETEKHNVWATHACVPTDPNPQEIHLENVT
EEFNMWKNNMVEQMHTDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGELKNCS
FNMTTELRDKKQKVYSLFYRLDVVQINENQGNRSNNSNKEYRLINCNTSAITQACPKVSF
EPIPIHYCAPAGFAILKCKDKKFNGTGPCPSVSTVQCTHGIKPVVSTQLLLNGSLAEEEV
MIRSENITNNAKNILVQFNTPVQINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHC
NVSKATWNETLGKVVKQLRKHFGNNTIIRFANSSGGDLEVTTHSFNCGGEFFYCNTSGLF
NSTWISNTSVQGSNSTGSNDSITLPCRIKQIINMWQRIGQAMYAPPIQGVIRCVSNITGL
ILTRDGGSTNSTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRRVVGRRRRR
R
Sequence of entity 5 (H), FASTA
>5U7M_5 PGT122 FAB HEAVY CHAIN (chains H)
QVHLQESGPGLVKPSETLSLTCNVSGTLVRDNYWSWIRQPLGKQPEWIGYVHDSGDTNYN
PSLKSRVHLSLDKSKNLVSLRLTGVTAADSAIYYCATTKHGRRIYGVVAFKEWFTYFYMD
VWGKGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Sequence of entity 6 (L), FASTA
>5U7M_6 PGT122 FAB LIGHT CHAIN (chains L)
APTFVSVAPGQTARITCGEESLGSRSVIWYQQRPGQAPSLIIYNNNDRPSGIPDRFSGSP
GSTFGTTATLTITSVEAGDEADYYCHIWDSRRPTNWVFGEGTTLIVLSQPKAAPSVTLFP
PSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLS
LTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| 83G | 1-[(2R)-4-(benzenecarbonyl)-2-methylpiperazin-1-yl]-2-(4-methoxy-1H-pyrrolo[2,3… | C22 H22 N4 O4 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 9 |
Water and common crystallization additives (SO4) are not listed.
Primary citation
Crystal structures of trimeric HIV envelope with entry inhibitors BMS-378806 and BMS-626529. Pancera, M., Lai, Y.T., Bylund, T. et al. Nat Chem Biol (2017) 13:1115-1122. DOI 10.1038/nchembio.2460 · PubMed
Other PDB entries of the same protein (UniProt Q2N0S5), best resolution first:
- 6CDO 2.1 Å, Structure of vaccine-elicited HIV-1 neutralizing antibody vFP16.02 in complex with HIV-1…
- 6CDM 2.41 Å, Structure of vaccine-elicited HIV-1 neutralizing antibody vFP7.04 in complex with HIV-1…
- 6CDP 2.46 Å, Vaccine-elicited HIV-1 neutralizing antibody vFP20.01 in complex with HIV-1 fusion…
- 9P6E 2.7 Å, N49P7-FR Fab in complex with BG505 MD39 SOSIP and RM20A3 Fab
- 9P6G 2.7 Å, eN49P7-FRv1-23 Fab in complex with BG505 MD39 SOSIP and RM20A3 Fab
- 8TTW 2.96 Å, Cryo-EM structure of BG505 SOSIP.664 HIV-1 Env trimer in complex with temsavir, 8ANC195,…
- 9Y9V 2.98 Å, The cryoem structure of rhesus macaque 1A8 and PGT121 fabs in complex with BG505…
- 9Q0W 3.0 Å, Cryo-EM Structure of HIV-1 BG505DS-SOSIP.664 Env Trimer Bound to DFPH-a.01_10R59P_LC Fab
- 9Q3S 3.01 Å, Cryo-EM structure of PGT121 Fab and Rhesus macaque Ab4 Fab in complex with HIV-1 Env…
- 5U7O 3.03 Å, Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to Small Molecule…
- 4TVP 3.1 Å, Crystal Structure of the HIV-1 BG505 SOSIP.664 Env Trimer Ectodomain, Comprising…
- 8TKC 3.1 Å, cryo-EM structure of HIV-1 BG505DS-SOSIP.664 env trimer bound to DJ85-b.01 FAB
Browse structure collections
About this viewer
MolViewer shows 5U7M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.