Crystal structure of GLUN1/GLUN2A ligand-binding domain in complex with glycine and nvp-AAM077. Determined by X-ray diffraction at 1.6 Å resolution. Released 17 May 2017.
Explore 5U8C in 3D Show helices and sheets RCSB PDB PDBe
5U8C contains 36 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 13 | 1 | 2 |
| β-strand | 17 | 1 | 2 |
| β-strand | 18-21 | 4 | 1 |
| α-helix | 22-23 | 2 | |
| α-helix | 28-30 | 3 | |
| β-strand | 32 | 1 | 3 |
| β-strand | 38 | 1 | 3 |
| β-strand | 42-46 | 5 | 1 |
| β-strand | 59-64 | 6 | 1 |
| α-helix | 66-78 | 13 | |
| β-strand | 81-86 | 6 | 1 |
| β-strand | 95-97 | 3 | 4 |
| β-strand | 104-106 | 3 | 4 |
| α-helix | 108-115 | 8 | |
| β-strand | 120-121 | 2 | 1 |
| β-strand | 126 | 1 | 5 |
| α-helix | 129-132 | 4 | |
| β-strand | 136-137 | 2 | 1 |
| α-helix | 138 | 1 | |
| α-helix | 140 | 1 | |
| β-strand | 142-151 | 10 | 5 |
| α-helix | 162-165 | 4 | |
| β-strand | 173-174 | 2 | 5 |
| β-strand | 176 | 1 | 6 |
| α-helix | 180-187 | 8 | |
| α-helix | 189-191 | 3 | |
| α-helix | 192-198 | 7 | |
| β-strand | 203 | 1 | 6 |
| α-helix | 206-214 | 9 | |
| β-strand | 220-224 | 5 | 5 |
| α-helix | 225-234 | 10 | |
| β-strand | 238-250 | 13 | 5 |
| β-strand | 253-254 | 2 | 1 |
| α-helix | 261-273 | 13 | |
| α-helix | 276-280 | 5 | |
| α-helix | 281-285 | 5 | |
| α-helix | 288-290 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| β-strand | 8-13 | 6 | 7 |
| β-strand | 16 | 1 | 8 |
| β-strand | 20 | 1 | 8 |
| β-strand | 21-24 | 4 | 7 |
| α-helix | 25-26 | 2 | |
| β-strand | 37-44 | 8 | 7 |
| β-strand | 52-60 | 9 | 7 |
| α-helix | 62-70 | 9 | |
| α-helix | 71-75 | 5 | |
| β-strand | 77-82 | 6 | 7 |
| β-strand | 91-92 | 2 | 9 |
| β-strand | 95-96 | 2 | 9 |
| α-helix | 98-104 | 7 | |
| β-strand | 110-111 | 2 | 7 |
| β-strand | 116 | 1 | 10 |
| α-helix | 119-122 | 4 | |
| β-strand | 125-127 | 3 | 7 |
| α-helix | 128-130 | 3 | |
| β-strand | 132-141 | 10 | 10 |
| α-helix | 152-155 | 4 | |
| α-helix | 157-159 | 3 | |
| α-helix | 163-165 | 3 | |
| β-strand | 166-167 | 2 | 10 |
| α-helix | 173-181 | 9 | |
| α-helix | 183-189 | 7 | |
| α-helix | 190-192 | 3 | |
| α-helix | 197-205 | 9 | |
| β-strand | 211-215 | 5 | 10 |
| α-helix | 216-224 | 9 | |
| β-strand | 231-233 | 3 | 10 |
| α-helix | 234-235 | 2 | |
| α-helix | 236-238 | 3 | |
| β-strand | 240-245 | 6 | 10 |
| β-strand | 248-250 | 3 | 7 |
| α-helix | 256-268 | 13 | |
| α-helix | 271-279 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutamate receptor ionotropic, NMDA 1 | A | protein | 292 | Rattus norvegicus | P35439 (AlphaFold model) |
| Glutamate receptor ionotropic, nmda 2A | B | protein | 283 | Rattus norvegicus | Q00959 (AlphaFold model) |
>5U8C_1 Glutamate receptor ionotropic, NMDA 1 (chains A) GMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVP QCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADM IVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSS VDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVT TGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS
>5U8C_2 GLUTAMATE RECEPTOR IONOTROPIC, NMDA 2A (chains B) SDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFC IDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSE VVDFSVPFVETGISVMVSRGTQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYP YMHQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATT GYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHN
| ID | Name | Formula | Copies |
|---|---|---|---|
| 84J | [(R)-{[(1S)-1-(4-bromophenyl)ethyl]amino}(2,3-dihydroxyquinoxalin-5-yl)methyl]p… | C17 H17 Br N3 O5 P | 1 |
| GLY | Glycine | C2 H5 N O2 | 1 |
Water and common crystallization additives (GOL) are not listed.
Novel Mode of Antagonist Binding in NMDA Receptors Revealed by the Crystal Structure of the GluN1-GluN2A Ligand-Binding Domain Complexed to NVP-AAM077. Romero-Hernandez, A., Furukawa, H. Mol Pharmacol (2017) 92:22-29. DOI 10.1124/mol.116.107912 · PubMed
Other PDB entries of the same protein (UniProt P35439 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5U8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.