5UAK: PDB entry 5UAK

Dephosphorylated, ATP-free human cystic fibrosis transmembrane conductance regulator (CFTR). Determined by electron microscopy at 3.87 Å resolution. Released 18 Jan 2017.

Method: Electron microscopy
Resolution: 3.87 Å
Organism: Homo sapiens
Chains: 2
Atoms: 9,232
Mol. weight: 170.99 kDa
Released: 18 Jan 2017

Explore 5UAK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UAK contains 60 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 59 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	11-16	6
α-helix	20-29	10
α-helix	38-41	4
α-helix	46-63	18
α-helix	69-76	8
α-helix	79-97	19
α-helix	100-108	9
β-strand	111	1	1
β-strand	113	1	1
α-helix	117-165	49
α-helix	169-172	4
α-helix	177-192	16
α-helix	193-195	3
α-helix	197-201	5
α-helix	203-214	12
α-helix	222-267	46
α-helix	269-275	7
α-helix	280-322	43
α-helix	323-328	6
α-helix	334-347	14
α-helix	348-353	6
α-helix	354-375	22
α-helix	382-384	3
β-strand	392	1	2
β-strand	393-398	6	3
β-strand	448	1	2
β-strand	453-458	6	4
α-helix	464-472	9
β-strand	479-483	5	3
β-strand	488-491	4	4
β-strand	500	1	5
α-helix	502-507	6
α-helix	511-512	2
α-helix	514-524	11
α-helix	527-532	6
β-strand	541	1	5
α-helix	550-563	14
β-strand	568-572	5	4
α-helix	580-594	15
β-strand	600-603	4	4
α-helix	607-612	6
β-strand	615-619	5	4
β-strand	624	1	4
β-strand	628	1	4
α-helix	630-636	7
α-helix	638-644	7
α-helix	846-853	8
α-helix	858-882	25
α-helix	917-921	5
α-helix	923-926	4
α-helix	936-956	21
α-helix	961-966	6
α-helix	969-974	6
α-helix	975-979	5
α-helix	980-985	6
α-helix	987-1011	25
α-helix	1015-1046	32
α-helix	1049-1060	12
α-helix	1062-1068	7
α-helix	1071-1120	50
α-helix	1127-1138	12
α-helix	1140-1168	29
β-strand	1210-1218	9	6
β-strand	1225-1234	10	6
β-strand	1239-1243	5	7
α-helix	1250-1258	9
β-strand	1262-1268	7	6
β-strand	1269	1	8
β-strand	1272	1	8
α-helix	1279-1282	4
α-helix	1283-1285	3
β-strand	1286-1289	4	7
α-helix	1300-1304	5
α-helix	1312-1322	11
α-helix	1325-1329	5
α-helix	1340-1342	3
α-helix	1348-1361	14
β-strand	1366-1370	5	7
α-helix	1372-1375	4
α-helix	1378-1391	14
β-strand	1396-1400	5	7
α-helix	1405-1407	3
β-strand	1412-1417	6	7
β-strand	1420-1424	5	7
α-helix	1427-1435	9

Chain R: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-17	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cystic fibrosis transmembrane conductance regulator	A	protein	1489	Homo sapiens	P13569 (AlphaFold model)
Cystic fibrosis transmembrane conductance regulator	R	protein	19	Homo sapiens

Sequence of entity 1 (A), FASTA

>5UAK_1 Cystic fibrosis transmembrane conductance regulator (chains A)
MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRE
LASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIA
IYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQL
VSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGL
GRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAA
YVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQT
WYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRK
TSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEG
KIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV
LGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR
ILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNS
ILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQ
MNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQG
QNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESI
PAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRN
NSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAP
MSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATV
PVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHK
ALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIM
STLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKK
DDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRL
LNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVAD
EVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVT
YQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQA
ISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRLSNSLEVLFQ

Sequence of entity 2 (R), FASTA

>5UAK_2 Cystic fibrosis transmembrane conductance regulator (chains R)
XXXXXXXXXXXXXXXXXXX

Primary citation

Molecular Structure of the Human CFTR Ion Channel. Liu, F., Zhang, Z., Csanady, L. et al. Cell (2017) 169:85-95.e8. DOI 10.1016/j.cell.2017.02.024 · PubMed

Other PDB entries of the same protein (UniProt P13569 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PZE 1.7 Å, Minimal human CFTR first nucleotide binding domain as a head-to-tail dimer
7QI1 1.76 Å, Crystal structure of human 14-3-3 protein beta in complex with CFTR peptide pS753pS768…
2PZG 1.8 Å, Minimal human CFTR first nucleotide binding domain as a monomer
5TFJ 1.85 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
6WBS 1.86 Å, Human CFTR first nucleotide binding domain with dF508/V510D
6HEP 1.86 Å, Crystal structure of human 14-3-3 beta in complex with CFTR R-domain peptide pS753-pS768
5TF8 1.86 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFA 1.87 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFB 1.87 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFD 1.89 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFF 1.89 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFI 1.89 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…

Browse more

5UAK is part of these collections:

About this viewer

MolViewer shows 5UAK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.