5UGW: Human telomerase thumb domain

Structure of the human telomerase thumb domain. Determined by X-ray diffraction at 2.31 Å resolution. Released 8 Feb 2017.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,300
Mol. weight: 20.11 kDa
Ligands: GSH
Released: 8 Feb 2017

Explore 5UGW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UGW contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	966-983	18
α-helix	984-986	3
α-helix	994-1017	24
α-helix	1025-1027	3
α-helix	1029-1050	22
α-helix	1064-1066	3
α-helix	1067-1082	16
α-helix	1083-1085	3
α-helix	1086-1104	19
α-helix	1111-1118	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomerase reverse transcriptase	A	protein	175	Homo sapiens	O14746 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5UGW_1 Telomerase reverse transcriptase (chains A)
SNANRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVL
QLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQA
FLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD

Ligands and cofactors

ID	Name	Formula	Copies
GSH	Glutathione	C10 H17 N3 O6 S	2

Primary citation

Structural Analysis Reveals the Deleterious Effects of Telomerase Mutations in Bone Marrow Failure Syndromes. Hoffman, H., Rice, C., Skordalakes, E. J Biol Chem (2017) 292:4593-4601. DOI 10.1074/jbc.M116.771204 · PubMed

Other PDB entries of the same protein (UniProt O14746 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MEO 1.77 Å, Human Leukocyte Antigen presenting ILGKFLHRL
5MER 1.88 Å, Human Leukocyte Antigen A02 presenting ILAKFLHEL
5MEQ 2.27 Å, Human Leukocyte Antigen A02 presenting ILAKFLHTL
4B18 2.52 Å, The crystal structure of human Importin alpha 5 with TERT NLS peptide
9Q16 2.7 Å, Human telomerase catalytic core with shelterin protein TPP1, dGpNHpp and DNA primer…
5MEP 2.71 Å, Human Leukocyte Antigen A02 presenting ILGKFLHWL
4MNQ 2.74 Å, TCR-peptide specificity overrides affinity enhancing TCR-MHC interactions
2BCK 2.8 Å, Crystal Structure of HLA-A*2402 Complexed with a telomerase peptide
9Q12 2.8 Å, Human telomerase catalytic core with shelterin protein TPP1 and DNA primer ending in TTAG
5MEN 2.81 Å, Human Leukocyte Antigen A02 presenting ILAKFLHWL, in complex with cognate T-Cell Receptor
9Q10 2.9 Å, Human telomerase catalytic core with shelterin protein TPP1, dTpNHpp and DNA primer…
9Q11 2.9 Å, Human telomerase catalytic core with shelterin protein TPP1, BIBR1532, dTpNHpp and DNA…

Browse structure collections

About this viewer

MolViewer shows 5UGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.