5UJ8: Origin recognition complex subunit 3
Human Origin Recognition Complex subunits 2 and 3. Determined by X-ray diffraction at 6.0 Å resolution. Released 8 Feb 2017.
- Method
- X-ray diffraction
- Resolution
- 6.0 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 24,144
- Mol. weight
- 490.98 kDa
- Released
- 8 Feb 2017
Explore 5UJ8 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5UJ8 contains 185 α-helices and 72 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 37 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 42-80 | 39 | |
| β-strand | 103-104 | 2 | 1 |
| β-strand | 107 | 1 | 2 |
| α-helix | 112-114 | 3 | |
| α-helix | 115-127 | 13 | |
| β-strand | 134-136 | 3 | 1 |
| α-helix | 145-157 | 13 | |
| α-helix | 161-163 | 3 | |
| α-helix | 190-192 | 3 | |
| α-helix | 197-200 | 4 | |
| α-helix | 201-205 | 5 | |
| α-helix | 212-214 | 3 | |
| β-strand | 216 | 1 | 3 |
| β-strand | 217-219 | 3 | 1 |
| α-helix | 227-239 | 13 | |
| β-strand | 247 | 1 | 3 |
| β-strand | 249-250 | 2 | 1 |
| α-helix | 256-262 | 7 | |
| α-helix | 265-270 | 6 | |
| β-strand | 274-275 | 2 | 1 |
| β-strand | 278 | 1 | 2 |
| α-helix | 281-288 | 8 | |
| α-helix | 289-293 | 5 | |
| β-strand | 301-302 | 2 | 4 |
| α-helix | 304-312 | 9 | |
| α-helix | 313-317 | 5 | |
| α-helix | 321-336 | 16 | |
| α-helix | 340-344 | 5 | |
| α-helix | 348-357 | 10 | |
| α-helix | 360-366 | 7 | |
| α-helix | 373-377 | 5 | |
| α-helix | 382-384 | 3 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-423 | 33 | |
| α-helix | 435-444 | 10 | |
| α-helix | 451-463 | 13 | |
| α-helix | 465-481 | 17 | |
| α-helix | 482-486 | 5 | |
| α-helix | 493-505 | 13 | |
| α-helix | 549-556 | 8 | |
| α-helix | 557-564 | 8 | |
| β-strand | 578 | 1 | 4 |
| β-strand | 581-582 | 2 | 4 |
| α-helix | 585-591 | 7 | |
| α-helix | 596-605 | 10 | |
| α-helix | 629-639 | 11 | |
| α-helix | 646-650 | 5 | |
| α-helix | 652-656 | 5 | |
| α-helix | 679-690 | 12 | |
| β-strand | 696-697 | 2 | 5 |
| β-strand | 703-704 | 2 | 5 |
Chain B: 37 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 42-80 | 39 | |
| β-strand | 103-104 | 2 | 6 |
| α-helix | 112-114 | 3 | |
| α-helix | 115-127 | 13 | |
| β-strand | 134-136 | 3 | 6 |
| α-helix | 145-157 | 13 | |
| α-helix | 161-163 | 3 | |
| α-helix | 190-192 | 3 | |
| α-helix | 197-200 | 4 | |
| α-helix | 201-205 | 5 | |
| α-helix | 212-214 | 3 | |
| β-strand | 216 | 1 | 7 |
| β-strand | 217-219 | 3 | 6 |
| α-helix | 227-239 | 13 | |
| β-strand | 247 | 1 | 7 |
| β-strand | 249-250 | 2 | 6 |
| α-helix | 256-262 | 7 | |
| α-helix | 265-270 | 6 | |
| β-strand | 275 | 1 | 6 |
| α-helix | 281-288 | 8 | |
| α-helix | 289-293 | 5 | |
| β-strand | 301-302 | 2 | 8 |
| α-helix | 304-312 | 9 | |
| α-helix | 313-317 | 5 | |
| α-helix | 321-336 | 16 | |
| α-helix | 340-344 | 5 | |
| α-helix | 348-357 | 10 | |
| α-helix | 360-366 | 7 | |
| α-helix | 373-377 | 5 | |
| α-helix | 382-384 | 3 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-423 | 33 | |
| α-helix | 435-444 | 10 | |
| α-helix | 451-463 | 13 | |
| α-helix | 465-481 | 17 | |
| α-helix | 482-486 | 5 | |
| α-helix | 493-505 | 13 | |
| α-helix | 551-556 | 6 | |
| α-helix | 557-566 | 10 | |
| β-strand | 578 | 1 | 8 |
| β-strand | 581-582 | 2 | 8 |
| α-helix | 585-591 | 7 | |
| α-helix | 596-605 | 10 | |
| α-helix | 629-639 | 11 | |
| α-helix | 646-650 | 5 | |
| α-helix | 653-656 | 4 | |
| α-helix | 679-690 | 12 | |
| β-strand | 696-697 | 2 | 9 |
| β-strand | 703-704 | 2 | 9 |
Chain C: 36 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 42-80 | 39 | |
| β-strand | 103-104 | 2 | 10 |
| β-strand | 107 | 1 | 11 |
| α-helix | 112-114 | 3 | |
| α-helix | 115-127 | 13 | |
| β-strand | 134-136 | 3 | 10 |
| α-helix | 145-157 | 13 | |
| α-helix | 161-163 | 3 | |
| α-helix | 190-192 | 3 | |
| α-helix | 197-200 | 4 | |
| α-helix | 201-205 | 5 | |
| α-helix | 212-214 | 3 | |
| β-strand | 216 | 1 | 12 |
| β-strand | 217-219 | 3 | 10 |
| α-helix | 227-239 | 13 | |
| β-strand | 247 | 1 | 12 |
| β-strand | 249-250 | 2 | 10 |
| α-helix | 256-262 | 7 | |
| α-helix | 265-271 | 7 | |
| β-strand | 274-275 | 2 | 10 |
| β-strand | 278 | 1 | 11 |
| α-helix | 281-288 | 8 | |
| α-helix | 289-293 | 5 | |
| β-strand | 301-302 | 2 | 13 |
| α-helix | 304-312 | 9 | |
| α-helix | 313-317 | 5 | |
| α-helix | 321-336 | 16 | |
| α-helix | 340-344 | 5 | |
| α-helix | 348-357 | 10 | |
| α-helix | 360-366 | 7 | |
| α-helix | 373-377 | 5 | |
| α-helix | 385-388 | 4 | |
| α-helix | 391-423 | 33 | |
| α-helix | 435-444 | 10 | |
| α-helix | 451-463 | 13 | |
| α-helix | 465-481 | 17 | |
| α-helix | 482-486 | 5 | |
| α-helix | 493-505 | 13 | |
| α-helix | 551-556 | 6 | |
| α-helix | 557-564 | 8 | |
| β-strand | 578 | 1 | 13 |
| β-strand | 581-582 | 2 | 13 |
| α-helix | 585-591 | 7 | |
| α-helix | 596-605 | 10 | |
| α-helix | 629-639 | 11 | |
| α-helix | 646-650 | 5 | |
| α-helix | 652-656 | 5 | |
| α-helix | 679-690 | 12 | |
| β-strand | 696-697 | 2 | 14 |
| β-strand | 703-704 | 2 | 14 |
Chain D: 35 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 42-80 | 39 | |
| β-strand | 103-104 | 2 | 15 |
| α-helix | 112-114 | 3 | |
| α-helix | 115-127 | 13 | |
| β-strand | 134-136 | 3 | 15 |
| α-helix | 145-157 | 13 | |
| α-helix | 161-163 | 3 | |
| α-helix | 197-200 | 4 | |
| α-helix | 201-205 | 5 | |
| α-helix | 212-214 | 3 | |
| β-strand | 216 | 1 | 16 |
| β-strand | 217-219 | 3 | 15 |
| α-helix | 227-239 | 13 | |
| β-strand | 247 | 1 | 16 |
| β-strand | 249-250 | 2 | 15 |
| α-helix | 256-262 | 7 | |
| α-helix | 265-271 | 7 | |
| β-strand | 274-275 | 2 | 15 |
| α-helix | 281-288 | 8 | |
| α-helix | 289-293 | 5 | |
| β-strand | 301-302 | 2 | 17 |
| α-helix | 304-312 | 9 | |
| α-helix | 313-317 | 5 | |
| α-helix | 321-336 | 16 | |
| α-helix | 340-344 | 5 | |
| α-helix | 348-357 | 10 | |
| α-helix | 360-366 | 7 | |
| α-helix | 373-377 | 5 | |
| α-helix | 382-388 | 7 | |
| α-helix | 391-423 | 33 | |
| α-helix | 435-444 | 10 | |
| α-helix | 451-463 | 13 | |
| α-helix | 465-481 | 17 | |
| α-helix | 482-486 | 5 | |
| α-helix | 493-505 | 13 | |
| α-helix | 551-556 | 6 | |
| α-helix | 557-564 | 8 | |
| β-strand | 578 | 1 | 17 |
| β-strand | 581-582 | 2 | 17 |
| α-helix | 585-591 | 7 | |
| α-helix | 596-605 | 10 | |
| α-helix | 629-639 | 11 | |
| α-helix | 646-650 | 5 | |
| α-helix | 652-656 | 5 | |
| α-helix | 679-690 | 12 | |
| β-strand | 696-697 | 2 | 18 |
| β-strand | 703-704 | 2 | 18 |
Chain E: 10 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 286-307 | 22 | |
| β-strand | 310-314 | 5 | 19 |
| α-helix | 320-325 | 6 | |
| α-helix | 326-331 | 6 | |
| β-strand | 336-340 | 5 | 19 |
| α-helix | 348-354 | 7 | |
| α-helix | 355-359 | 5 | |
| α-helix | 365-366 | 2 | |
| α-helix | 369-380 | 12 | |
| β-strand | 388-393 | 6 | 19 |
| α-helix | 403-414 | 12 | |
| β-strand | 418-424 | 7 | 19 |
| α-helix | 429-432 | 4 | |
| α-helix | 435-440 | 6 | |
| β-strand | 443-446 | 4 | 19 |
Chains F, G and H: 10 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 286-307 | 22 | |
| β-strand | 310-314 | 5 | 20 |
| α-helix | 320-325 | 6 | |
| α-helix | 326-331 | 6 | |
| β-strand | 336-340 | 5 | 20 |
| α-helix | 348-354 | 7 | |
| α-helix | 355-359 | 5 | |
| α-helix | 365-366 | 2 | |
| α-helix | 369-380 | 12 | |
| β-strand | 388-393 | 6 | 20 |
| α-helix | 405-414 | 10 | |
| β-strand | 418-424 | 7 | 20 |
| α-helix | 429-432 | 4 | |
| α-helix | 435-440 | 6 | |
| β-strand | 443-446 | 4 | 20 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Origin recognition complex subunit 3 | A, B, C, D | protein | 712 | Homo sapiens | Q9UBD5 (AlphaFold model) |
| Origin recognition complex subunit 2 | E, F, G, H | protein | 347 | Homo sapiens | Q13416 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>5UJ8_1 Origin recognition complex subunit 3 (chains A, B, C, D)
MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENER
LQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGS
LTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYS
MDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQH
LHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPF
KINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSN
NQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLH
KFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFK
SYCENHLGSTAKRIEEFLAQFQSLDAETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKEL
RRSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIAL
HTALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAA
EKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC
Sequence of entity 2 (E, F, G, H), FASTA
>5UJ8_2 Origin recognition complex subunit 2 (chains E, F, G, H)
MKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQL
NQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKS
VLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIG
QLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSG
SLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDL
TLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA
Primary citation
Structure of the active form of human Origin Recognition Complex and its ATPase motor module. Tocilj, A., On, K.F., Yuan, Z. et al. Elife (2017) 6. DOI 10.7554/eLife.20818 · PubMed
Other PDB entries of the same protein (UniProt Q9UBD5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 11RL 2.8 Å, CryoEM structure of the human origin recognition complex with DNA and CDC6 protein
- 7JPO 3.2 Å, ORC-O1AAA: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC2 WH
- 7JPQ 3.5 Å, ORC-O2-5: Human Origin Recognition Complex (ORC) with subunits 2,3,4,5
- 8S0D 3.6 Å, H. sapiens MCM bound to double stranded DNA and ORC1-6
- 7JPP 3.7 Å, ORC-O2WH: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC1 AAA+ domain
- 7CTE 3.8 Å, Human Origin Recognition Complex, ORC2-5
- 8S0E 3.8 Å, H. sapiens OCCM bound to double stranded DNA
- 7JPR 4.0 Å, ORC-OPEN: Human Origin Recognition Complex (ORC) in an open conformation
- 8S0C 4.0 Å, H. sapiens ORC1-5 bound to double stranded DNA as part of the MCM-ORC complex
- 8S0F 4.1 Å, H. sapiens OC1M bound to double stranded DNA
- 7JPS 4.4 Å, ORC-DNA: Human Origin Recognition Complex (ORC) with DNA bound in the core
- 7CTF 4.8 Å, Human origin recognition complex 1-5 State II
Browse structure collections
About this viewer
MolViewer shows 5UJ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.