5UN9: Human O-GlcNAcase

The crystal structure of human O-GlcNAcase in complex with Thiamet-G. Determined by X-ray diffraction at 2.5 Å resolution. Released 15 Mar 2017.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,189
Mol. weight: 116.14 kDa
Ligands: NHT
Released: 15 Mar 2017

Explore 5UN9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UN9 contains 44 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	61-66	6	1
α-helix	72-73	2
α-helix	75-87	13
β-strand	92-95	4	1
α-helix	110-111	2
α-helix	113-128	16
β-strand	132-137	6	1
α-helix	148-162	15
β-strand	168-172	5	1
α-helix	182-187	6
α-helix	191-205	15
β-strand	212-215	4	1
α-helix	221-223	3
α-helix	232-240	9
β-strand	246-249	4	1
α-helix	261-271	11
α-helix	274-275	2
β-strand	276-279	4	1
α-helix	301-306	6
β-strand	309-312	4	1
α-helix	318-321	4
α-helix	322-332	11
α-helix	376-388	13
α-helix	555-564	10
β-strand	567	1	2
β-strand	570	1	2
α-helix	573-587	15
α-helix	588-590	3
α-helix	605-629	25
α-helix	634-661	28
α-helix	684-691	8

Chain B: 23 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	61-66	6	3
α-helix	72-73	2
α-helix	75-87	13
β-strand	92-95	4	3
α-helix	110-111	2
α-helix	113-128	16
β-strand	132-137	6	3
α-helix	148-162	15
β-strand	168-172	5	3
α-helix	182-187	6
α-helix	191-205	15
β-strand	212-215	4	3
α-helix	221-223	3
α-helix	232-240	9
β-strand	246-249	4	3
α-helix	261-271	11
α-helix	274-275	2
β-strand	276-279	4	3
α-helix	301-306	6
β-strand	309-312	4	3
α-helix	318-321	4
α-helix	322-331	10
α-helix	376-388	13
α-helix	555-564	10
β-strand	567	1	4
β-strand	570	1	4
α-helix	573-587	15
α-helix	588-591	4
α-helix	604-629	26
α-helix	634-662	29
α-helix	663-665	3
α-helix	678-680	3
α-helix	684-691	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein O-GlcNAcase	A, B	protein	504	Homo sapiens	O60502 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UN9_1 Protein O-GlcNAcase (chains A, B)
HFLCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQ
LMTLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDH
NMCAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVG
EKLLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKG
RSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIK
LENEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRGGGGSGGGGSVTLEDLQL
LADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCGL
VMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWA
FRGGLAGEFQRLLPIDGANDLFFQ

Ligands and cofactors

ID	Name	Formula	Copies
NHT	(3AR,5R,6S,7R,7AR)-2-(ethylamino)-5-(hydroxymethyl)-5,6,7,7A-tetrahydro-3AH-pyr…	C9 H16 N2 O4 S	2

Primary citation

Structures of human O-GlcNAcase and its complexes reveal a new substrate recognition mode. Li, B., Li, H., Lu, L. et al. Nat Struct Mol Biol (2017) 24:362-369. DOI 10.1038/nsmb.3390 · PubMed

Other PDB entries of the same protein (UniProt O60502 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UN8 2.13 Å, Crystal Structure of human O-GlcNAcase in complex with glycopeptide p53
5M7U 2.3 Å, Structure of human O-GlcNAc hydrolase with new iminocyclitol type inhibitor
11LJ 2.33 Å, Human oga in complex with ligand 24
5M7R 2.35 Å, Structure of human O-GlcNAc hydrolase
5M7S 2.4 Å, Structure of human O-GlcNAc hydrolase with bound transition state analog ThiametG
7OU6 2.41 Å, Human O-GlcNAc hydrolase in complex with DNJNAc-thiazolidines
5TKE 2.48 Å, Crystal Structure of Eukaryotic Hydrolase
8P0L 2.5 Å, Crystal structure of human O-GlcNAcase in complex with an S-linked CKII peptide
9BA8 2.54 Å, O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer's Disease
2YDQ 2.6 Å, CpOGA D298N in complex with hOGA-derived O-GlcNAc peptide
5M7T 2.6 Å, Structure of human O-GlcNAc hydrolase with PugNAc type inhibitor
5VVO 2.6 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase

Browse structure collections

About this viewer

MolViewer shows 5UN9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.