5UW2: E. coli MCE protein MlaD, periplasmic domain

Structure of E. coli MCE protein MlaD, periplasmic domain. Determined by X-ray diffraction at 2.85 Å resolution. Released 12 Apr 2017.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Escherichia coli O157:H7
Chains: 3
Atoms: 2,563
Mol. weight: 54.31 kDa
Ligands: ZN
Released: 12 Apr 2017

Explore 5UW2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UW2 contains 6 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	1
β-strand	57-60	4	1
β-strand	63-73	11	1
β-strand	80-87	8	1
β-strand	94	1	2
β-strand	98-103	6	1
β-strand	110-115	6	1
α-helix	116-118	3
β-strand	127	1	2
β-strand	132-133	2	1
β-strand	137-138	2	1
α-helix	143-151	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable phospholipid ABC transporter-binding protein MlaD	A, B, C	protein	165	Escherichia coli O157:H7	P64605 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5UW2_1 Probable phospholipid ABC transporter-binding protein MlaD (chains A, B, C)
MHHHHHHENLYFQTSIRTEPTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTY
LPRVTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQDTK
SAMVLEDLIGQFLYGSKGDDNKNSGDAPAAAPGNNETTEPVGTTK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	6

Primary citation

Architectures of Lipid Transport Systems for the Bacterial Outer Membrane. Ekiert, D.C., Bhabha, G., Isom, G.L. et al. Cell (2017) 169:273-285.e17. DOI 10.1016/j.cell.2017.03.019 · PubMed

Other PDB entries of the same protein (UniProt P64605 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UW8 2.15 Å, Structure of E. coli MCE protein MlaD, core MCE domain

Browse structure collections

About this viewer

MolViewer shows 5UW2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.