OTU protease of Crimean Congo Hemorrhagic Fever Virus bound to ubiquitin variant CC.1. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 May 2017.
Explore 5V5I in 3D Show helices and sheets RCSB PDB PDBe
5V5I contains 20 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| β-strand | 10-13 | 4 | 1 |
| β-strand | 16-19 | 4 | 1 |
| β-strand | 24 | 1 | 2 |
| α-helix | 25-27 | 3 | |
| β-strand | 29-32 | 4 | 1 |
| α-helix | 40-49 | 10 | |
| α-helix | 58-72 | 15 | |
| α-helix | 73-75 | 3 | |
| α-helix | 77-81 | 5 | |
| α-helix | 86-94 | 9 | |
| α-helix | 102-112 | 11 | |
| β-strand | 116-121 | 6 | 1 |
| β-strand | 126 | 1 | 2 |
| β-strand | 127-133 | 7 | 1 |
| β-strand | 142-147 | 6 | 1 |
| β-strand | 151-157 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 3 |
| β-strand | 12-16 | 5 | 3 |
| β-strand | 22 | 1 | 4 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 3 |
| β-strand | 48-49 | 2 | 3 |
| β-strand | 55 | 1 | 4 |
| β-strand | 66-71 | 6 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| β-strand | 10-13 | 4 | 5 |
| β-strand | 16-19 | 4 | 5 |
| β-strand | 24 | 1 | 6 |
| α-helix | 25-28 | 4 | |
| β-strand | 29-32 | 4 | 5 |
| α-helix | 40-49 | 10 | |
| α-helix | 58-72 | 15 | |
| α-helix | 73-75 | 3 | |
| α-helix | 77-81 | 5 | |
| α-helix | 86-94 | 9 | |
| β-strand | 101 | 1 | 7 |
| α-helix | 102-111 | 10 | |
| β-strand | 116-121 | 6 | 5 |
| β-strand | 126 | 1 | 6 |
| β-strand | 127-133 | 7 | 5 |
| β-strand | 142-147 | 6 | 5 |
| β-strand | 151-157 | 7 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 8 |
| β-strand | 12-16 | 5 | 8 |
| β-strand | 22 | 1 | 9 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-44 | 4 | 8 |
| β-strand | 49 | 1 | 8 |
| β-strand | 55 | 1 | 9 |
| β-strand | 66-71 | 6 | 8 |
| β-strand | 74 | 1 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNA-directed RNA polymerase L | A, C | protein | 174 | Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) | Q6TQR6 (AlphaFold model) |
| Ubiquitin variant CC.1 | B, D | protein | 105 | synthetic construct |
>5V5I_1 RNA-directed RNA polymerase L (chains A, C) GPLGSMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTD HSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGIT IIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFETDTREAL
>5V5I_2 Ubiquitin variant CC.1 (chains B, D) MAHHHHHHVTSLYKKAGSTDYKDDDDKMQIFVKTLKGHVITLEVEPSDTIENVKAKIQDK EGIPPDQQRLIFALQQLEDGRTLSDYNIQKESNLHLVLRLGGGRR
OTU protease of Crimean Congo Hemorrhagic Fever Virus bound to ubiquitin variant CC.1. Zhang, W., Bailey-Elkin, B.A., Knaap, R.C.M. et al. To be published.
Other PDB entries of the same protein (UniProt Q6TQR6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5V5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.