5V5W: PDB entry 5V5W

Molecular Mechanism of MDGA1: Regulation of Neuroligin 2:Neurexin Trans-synaptic Bridges. Determined by X-ray diffraction at 2.72 Å resolution. Released 5 Jul 2017.

Method: X-ray diffraction
Resolution: 2.72 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,596
Mol. weight: 26.22 kDa
Released: 5 Jul 2017

Explore 5V5W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5V5W contains 7 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	23-33	11	1
β-strand	37-40	4	2
β-strand	45-51	7	2
β-strand	56-65	10	1
α-helix	67-68	2
β-strand	69-74	6	2
α-helix	81-83	3
β-strand	87-88	2	2
β-strand	93-95	3	1
α-helix	100-102	3
β-strand	104-111	8	2
α-helix	117	1
β-strand	118-127	10	2
β-strand	128-129	2	3
α-helix	130-132	3
β-strand	133-139	7	4
β-strand	152-158	7	4
β-strand	161-162	2	3
α-helix	164-165	2
β-strand	166-170	5	5
β-strand	174	1	5
β-strand	184-187	4	4
β-strand	196-201	6	4
β-strand	211-217	7	5
α-helix	221-223	3
β-strand	227-232	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MAM domain-containing glycosylphosphatidylinositol anchor protein 1	A	protein	230	Homo sapiens	Q8NFP4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5V5W_1 MAM domain-containing glycosylphosphatidylinositol anchor protein 1 (chains A)
VDYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSA
SDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQT
VSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQDNGVDIYEPLYTQGETKVL
KLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTGSASTSHHHHHH

Primary citation

Molecular Mechanism of MDGA1: Regulation of Neuroligin 2:Neurexin Trans-synaptic Bridges. Gangwar, S.P., Zhong, X., Seshadrinathan, S. et al. Neuron (2017) 94:1132-1141.e4. DOI 10.1016/j.neuron.2017.06.009 · PubMed

Other PDB entries of the same protein (UniProt Q8NFP4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XEQ 3.14 Å, Crystal Structure of human MDGA1 and human neuroligin-2 complex
5V5V 4.11 Å, Complex of NLGN2 with MDGA1 Ig1-Ig2

Browse structure collections

About this viewer

MolViewer shows 5V5W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.