Molecular Mechanism of MDGA1: Regulation of Neuroligin 2:Neurexin Trans-synaptic Bridges. Determined by X-ray diffraction at 2.72 Å resolution. Released 5 Jul 2017.
Explore 5V5W in 3D Show helices and sheets RCSB PDB PDBe
5V5W contains 7 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-33 | 11 | 1 |
| β-strand | 37-40 | 4 | 2 |
| β-strand | 45-51 | 7 | 2 |
| β-strand | 56-65 | 10 | 1 |
| α-helix | 67-68 | 2 | |
| β-strand | 69-74 | 6 | 2 |
| α-helix | 81-83 | 3 | |
| β-strand | 87-88 | 2 | 2 |
| β-strand | 93-95 | 3 | 1 |
| α-helix | 100-102 | 3 | |
| β-strand | 104-111 | 8 | 2 |
| α-helix | 117 | 1 | |
| β-strand | 118-127 | 10 | 2 |
| β-strand | 128-129 | 2 | 3 |
| α-helix | 130-132 | 3 | |
| β-strand | 133-139 | 7 | 4 |
| β-strand | 152-158 | 7 | 4 |
| β-strand | 161-162 | 2 | 3 |
| α-helix | 164-165 | 2 | |
| β-strand | 166-170 | 5 | 5 |
| β-strand | 174 | 1 | 5 |
| β-strand | 184-187 | 4 | 4 |
| β-strand | 196-201 | 6 | 4 |
| β-strand | 211-217 | 7 | 5 |
| α-helix | 221-223 | 3 | |
| β-strand | 227-232 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | A | protein | 230 | Homo sapiens | Q8NFP4 (AlphaFold model) |
>5V5W_1 MAM domain-containing glycosylphosphatidylinositol anchor protein 1 (chains A) VDYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSA SDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQT VSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQDNGVDIYEPLYTQGETKVL KLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTGSASTSHHHHHH
Molecular Mechanism of MDGA1: Regulation of Neuroligin 2:Neurexin Trans-synaptic Bridges. Gangwar, S.P., Zhong, X., Seshadrinathan, S. et al. Neuron (2017) 94:1132-1141.e4. DOI 10.1016/j.neuron.2017.06.009 · PubMed
Other PDB entries of the same protein (UniProt Q8NFP4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5V5W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.