5V89: DCN4 PONY domain

Structure of DCN4 PONY domain bound to CUL1 WHB. Determined by X-ray diffraction at 1.55 Å resolution. Released 24 May 2017.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,432
Mol. weight: 31.77 kDa
Released: 24 May 2017

Explore 5V89 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5V89 contains 16 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	104-114	11
β-strand	119-120	2	1
α-helix	122-132	11
α-helix	139-147	9
β-strand	156-157	2	1
α-helix	158-167	10
α-helix	173-177	5
α-helix	180-185	6
α-helix	186-188	3
α-helix	190-204	15
α-helix	206	1
β-strand	211-213	3	2
α-helix	214-225	12
α-helix	232-241	10
β-strand	246-248	3	2
α-helix	249-261	13
α-helix	277-289	13

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	704-722	19
β-strand	724-726	3	3
α-helix	727-737	11
α-helix	746-758	13
β-strand	762-764	3	3
β-strand	771-774	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DCN1-like protein 4	A	protein	193	Homo sapiens	Q92564 (AlphaFold model)
Cullin-1	C	protein	77	Homo sapiens	Q13616 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5V89_1 DCN1-like protein 4 (chains A)
GSSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQ
EWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKC
MLGLLLGKIWPLFPVFHQFLEQSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLL
DEFVEWYKDKQMS

Sequence of entity 2 (C), FASTA

>5V89_2 Cullin-1 (chains C)
GSNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEK
EYLERVDGEKDTYSYLA

Primary citation

Blocking an N-terminal acetylation-dependent protein interaction inhibits an E3 ligase. Scott, D.C., Hammill, J.T., Min, J. et al. Nat Chem Biol (2017) 13:850-857. DOI 10.1038/nchembio.2386 · PubMed

Browse structure collections

About this viewer

MolViewer shows 5V89 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.