Open conformation of KcsA non-inactivating E71A mutant. Determined by X-ray diffraction at 2.25 Å resolution. Released 6 Dec 2017.
Explore 5VK6 in 3D Show helices and sheets RCSB PDB PDBe
5VK6 contains 18 α-helices and 43 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 9-12 | 4 | 2 |
| β-strand | 18-24 | 7 | 1 |
| β-strand | 33-39 | 7 | 2 |
| β-strand | 46-51 | 6 | 2 |
| β-strand | 58-60 | 3 | 2 |
| β-strand | 68-73 | 6 | 1 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 2 |
| β-strand | 107-108 | 2 | 2 |
| β-strand | 112-116 | 5 | 2 |
| β-strand | 122 | 1 | 3 |
| α-helix | 123-124 | 2 | |
| β-strand | 125-129 | 5 | 4 |
| α-helix | 135-137 | 3 | |
| β-strand | 140-150 | 11 | 4 |
| β-strand | 151 | 1 | 3 |
| β-strand | 156-159 | 4 | 5 |
| α-helix | 160-162 | 3 | |
| β-strand | 164 | 1 | 5 |
| β-strand | 168-170 | 3 | 4 |
| α-helix | 171-173 | 3 | |
| β-strand | 174-176 | 3 | 4 |
| β-strand | 179-189 | 11 | 4 |
| β-strand | 199-204 | 6 | 5 |
| α-helix | 205-207 | 3 | |
| β-strand | 209-214 | 6 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 6 |
| β-strand | 10-13 | 4 | 7 |
| β-strand | 19-25 | 7 | 6 |
| β-strand | 33-38 | 6 | 7 |
| α-helix | 42-44 | 3 | |
| β-strand | 45-49 | 5 | 7 |
| β-strand | 53-54 | 2 | 7 |
| β-strand | 62-67 | 6 | 6 |
| β-strand | 70-75 | 6 | 6 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-90 | 6 | 7 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 7 |
| β-strand | 102-106 | 5 | 7 |
| β-strand | 111 | 1 | 8 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 9 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 9 |
| β-strand | 140 | 1 | 8 |
| β-strand | 145-150 | 6 | 10 |
| β-strand | 153-155 | 3 | 10 |
| β-strand | 159-163 | 5 | 9 |
| β-strand | 173-182 | 10 | 9 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-198 | 8 | 10 |
| β-strand | 201-210 | 10 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 27-51 | 25 | |
| α-helix | 62-73 | 12 | |
| α-helix | 86-94 | 9 | |
| α-helix | 95-100 | 6 | |
| α-helix | 101-120 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Antibody Heavy Chain | A | protein | 219 | Mus musculus | |
| Antibody Light Chain | B | protein | 212 | Mus musculus | |
| pH-gated potassium channel KcsA | C | protein | 96 | Streptomyces lividans | P0A334 (AlphaFold model) |
>5VK6_1 Antibody Heavy Chain (chains A) QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANY NEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAK TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY TLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
>5VK6_2 Antibody Light Chain (chains B) DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPS RFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPP SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT LTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
>5VK6_3 pH-gated potassium channel KcsA (chains C) WRCAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVT LWGRCVAVVVMVAGITSFGLVTAALATWFVGQCQQQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| F09 | Nonan-1-ol | C9 H20 O | 1 |
| 1EM | (1S)-2-hydroxy-1-[(nonanoyloxy)methyl]ethyl myristate | C26 H50 O5 | 1 |
Water and common crystallization additives (K) are not listed.
The gating cycle of a K+ channel at atomic resolution. Cuello, L.G., Cortes, D.M., Perozo, E. Elife (2017) 6. DOI 10.7554/eLife.28032 · PubMed
Other PDB entries of the same protein (UniProt P0A334 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5VK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.