5VQF: Pro-TGF-beta 1

Crystal Structure of pro-TGF-beta 1. Determined by X-ray diffraction at 2.9 Å resolution. Released 15 Nov 2017.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Sus scrofa
Chains: 4
Atoms: 10,753
Mol. weight: 167.16 kDa
Released: 15 Nov 2017

Explore 5VQF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VQF contains 56 α-helices and 86 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	3-27	25
α-helix	33-35	3
α-helix	39-41	3
α-helix	44-45	2
α-helix	46-56	11
β-strand	59-60	2	1
β-strand	77-83	7	1
α-helix	84-86	3
β-strand	101-107	7	2
α-helix	108-114	7
α-helix	118-120	3
β-strand	121-130	10	1
β-strand	137-143	7	2
β-strand	151-158	8	2
β-strand	165-170	6	1
α-helix	172-180	9
β-strand	185-192	8	2
α-helix	193-194	2
β-strand	195-199	5	3
β-strand	202-206	5	3
β-strand	219	1	1
β-strand	228-233	6	1
α-helix	236-238	3
β-strand	251-252	2	4
α-helix	253-256	4
β-strand	265-267	3	5
β-strand	270-272	3	6
β-strand	282-284	3	7
β-strand	287-289	3	6
β-strand	292-294	3	5
α-helix	300-302	3
α-helix	306	1
α-helix	308-311	4
α-helix	312-316	5
β-strand	327-329	3	4
β-strand	332-341	10	7
β-strand	344-355	12	7
β-strand	357-360	4	4

Chain B: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	3-27	25
α-helix	33-35	3
α-helix	39-41	3
α-helix	44-45	2
α-helix	46-56	11
β-strand	60	1	7
β-strand	77-83	7	7
α-helix	84-86	3
β-strand	101-107	7	8
α-helix	108-114	7
α-helix	118-120	3
β-strand	121-130	10	7
β-strand	137-143	7	8
β-strand	151-158	8	8
β-strand	165-170	6	7
α-helix	172-180	9
β-strand	185-192	8	8
α-helix	193	1
β-strand	194-199	6	3
β-strand	202-207	6	3
β-strand	219	1	7
β-strand	228-233	6	7
β-strand	265-267	3	9
β-strand	270-272	3	10
β-strand	282-284	3	1
β-strand	287-289	3	10
β-strand	292-294	3	9
β-strand	327-329	3	11
β-strand	332-341	10	1
β-strand	344-355	12	1
β-strand	358-360	3	11

Chain C: 17 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	3-27	25
α-helix	33-35	3
α-helix	39-41	3
α-helix	43-45	3
α-helix	46-56	11
β-strand	60	1	12
α-helix	70-72	3
β-strand	77-83	7	12
α-helix	84-86	3
β-strand	101-107	7	13
α-helix	108-114	7
α-helix	118-120	3
β-strand	121-130	10	12
β-strand	137-144	8	13
β-strand	150-158	9	13
β-strand	165-170	6	12
α-helix	172-180	9
β-strand	185-192	8	13
α-helix	193	1
β-strand	194-199	6	3
β-strand	202-207	6	3
β-strand	219	1	12
β-strand	228-233	6	12
β-strand	251-252	2	14
α-helix	253-256	4
β-strand	265-267	3	15
β-strand	270-272	3	16
β-strand	282-284	3	17
β-strand	287-289	3	16
β-strand	292-294	3	15
α-helix	304	1
α-helix	306	1
α-helix	308-311	4
α-helix	313-316	4
α-helix	319-321	3
β-strand	327-329	3	14
β-strand	332-341	10	17
β-strand	344-355	12	17
β-strand	357-360	4	14

Chain D: 13 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	5-27	23
α-helix	33-35	3
α-helix	39-41	3
α-helix	44-45	2
α-helix	46-56	11
β-strand	60	1	17
β-strand	77-83	7	17
α-helix	84-86	3
β-strand	101-107	7	18
α-helix	108-114	7
α-helix	118-120	3
β-strand	121-130	10	17
β-strand	137-143	7	18
β-strand	151-158	8	18
β-strand	165-170	6	17
α-helix	172-180	9
β-strand	185-192	8	18
α-helix	193	1
β-strand	194-199	6	3
β-strand	202-207	6	3
β-strand	219	1	17
β-strand	228-233	6	17
α-helix	236-238	3
β-strand	265-267	3	19
β-strand	270-272	3	20
β-strand	282-284	3	12
β-strand	287-289	3	20
β-strand	292-294	3	19
α-helix	307-312	6
α-helix	313-315	3
β-strand	327-329	3	21
β-strand	332-341	10	12
β-strand	344-355	12	12
β-strand	358-360	3	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor beta-1	A, B, C, D	protein	363	Sus scrofa	P07200 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5VQF_1 Transforming growth factor beta-1 (chains A, B, C, D)
GPLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGDVPPGPLPEAVLALYNSTRDR
VAGESVEPEPEPEADYYAKEVTRVLMVESGNQIYDKFKGTPHSLYMLFNTSELREAVPEP
VLLSRAELRLLRLKLKVEQHVELYQKYSQDSWRYLSNRLLAPSDSPEWLSFDVTGVVRQW
LTRREAIEGFRLSAHCSCDSKDNTLHVEINGFNSGRRGDLATIHGMNRPFLLLMATPLER
AQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCP
YIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSC
KCS

Primary citation

Prodomain-growth factor swapping in the structure of pro-TGF-beta 1. Zhao, B., Xu, S., Dong, X. et al. J Biol Chem (2018) 293:1579-1589. DOI 10.1074/jbc.M117.809657 · PubMed

Other PDB entries of the same protein (UniProt P07200 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6UJA 3.3 Å, Integrin alpha-v beta-8 in complex with pro-TGF-beta1

Browse structure collections

About this viewer

MolViewer shows 5VQF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.