Nuclear transport of the Neurospora crassa NIT2 transcription factor is mediated by Importin-alpha. Determined by X-ray diffraction at 2.5 Å resolution. Released 1 Nov 2017.
Explore 5VQI in 3D Show helices and sheets RCSB PDB PDBe
5VQI contains 32 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 83-91 | 9 | |
| α-helix | 95-108 | 14 | |
| α-helix | 117-123 | 7 | |
| α-helix | 126-132 | 7 | |
| α-helix | 138-151 | 14 | |
| α-helix | 156-164 | 9 | |
| α-helix | 168-174 | 7 | |
| α-helix | 180-194 | 15 | |
| α-helix | 198-206 | 9 | |
| α-helix | 210-219 | 10 | |
| α-helix | 223-237 | 15 | |
| α-helix | 243-245 | 3 | |
| α-helix | 246-249 | 4 | |
| α-helix | 252-259 | 8 | |
| α-helix | 265-279 | 15 | |
| α-helix | 283-291 | 9 | |
| α-helix | 294-301 | 8 | |
| α-helix | 307-320 | 14 | |
| α-helix | 325-333 | 9 | |
| α-helix | 336-343 | 8 | |
| α-helix | 349-362 | 14 | |
| α-helix | 367-375 | 9 | |
| α-helix | 379-385 | 7 | |
| α-helix | 391-403 | 13 | |
| α-helix | 413-420 | 8 | |
| α-helix | 424-429 | 6 | |
| α-helix | 430-432 | 3 | |
| α-helix | 436-458 | 23 | |
| α-helix | 469-477 | 9 | |
| α-helix | 479-484 | 6 | |
| α-helix | 485-488 | 4 | |
| α-helix | 492-505 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Importin subunit alpha | B | protein | 495 | Neurospora crassa | Q9C2K9 (AlphaFold model) |
| Nuclear localization sequence of NIT2 transcription factor (NIT2-NLS) | A, C | protein | 13 | Neurospora crassa | P19212 (AlphaFold model) |
>5VQI_1 Importin subunit alpha (chains B) MGSSHHHHHHSSGLVPRGSHMTESQLSEDLPKMVEGVFSSEIDKQIQATTKFRKLLSKER NPPIEEVIKTGVVGRFVEFLRSPHTLVQFEAAWALTNIASGSATQTQVVIEAGAVPIFVE LLGSPEPDVREQAVWALGNIAGDSPQCRDYVLSCGALRPLLTLLGDSRKLSMLRNATWTL SNFCRGKTPQPDWNTIAPALPVLAKLVYSLDDEVLIDACWAISYLSDGSNDKIQAVIEAG IPRRLVELLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGALPCLLSLLSSNKDGIRK EACWTISNITAGNSAQIQSVIDANIIPPLIHLLSHADLKTRKEACWAISNATSGGLQKPD QIRYLVAQGCIKPLCDLLACPDNKIIQVALDGLENILKVGELDKNAAGDGPDSINRYALF IEECGGMEKIHDCQTNANEEIYMKAYNIIEKYFSDEDEAGDEAMGAQQQFGFGASGGAQQ GGFNFGANGTESMDM
>5VQI_2 Nuclear localization sequence of NIT2 transcription factor (NIT2-NLS) (chains A, C) TISSKRQRRHSKS
Nuclear transport of the Neurospora crassa NIT-2 transcription factor is mediated by importin-alpha. Bernardes, N.E., Takeda, A.A.S., Dreyer, T.R. et al. Biochem J (2017) 474:4091-4104. DOI 10.1042/BCJ20170654 · PubMed
Other PDB entries of the same protein (UniProt Q9C2K9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5VQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.