5W1I: LbaCas13a

Crystal structure of LbaCas13a (C2c2) bound to mature crRNA (20-nt spacer). Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Sept 2017.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Lachnospiraceae bacterium
Chains: 4
Atoms: 24,245
Mol. weight: 374.19 kDa
Released: 13 Sept 2017

Explore 5W1I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W1I contains 166 α-helices and 70 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 83 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	20-25	6	1
β-strand	30-35	6	1
β-strand	45	1	1
α-helix	48-60	13
β-strand	69	1	2
α-helix	80-93	14
α-helix	100-103	4
α-helix	106-109	4
α-helix	112-127	16
α-helix	133-135	3
α-helix	136-139	4
α-helix	143-152	10
α-helix	155-163	9
α-helix	172-182	11
β-strand	183	1	2
α-helix	185-187	3
α-helix	190-203	14
α-helix	215-220	6
α-helix	221-227	7
α-helix	230-233	4
α-helix	236-241	6
β-strand	247-249	3	3
β-strand	255-257	3	3
α-helix	265-284	20
α-helix	289-308	20
α-helix	313-315	3
α-helix	324-332	9
β-strand	337	1	4
α-helix	340-344	5
α-helix	354-385	32
α-helix	395-413	19
α-helix	422-424	3
β-strand	425	1	4
α-helix	426-455	30
α-helix	458-460	3
β-strand	467-469	3	5
α-helix	475-477	3
α-helix	483-514	32
β-strand	515	1	6
α-helix	524-526	3
α-helix	527	1
β-strand	528	1	7
α-helix	529	1
β-strand	533	1	8
β-strand	541	1	8
β-strand	545	1	7
α-helix	546-548	3
β-strand	550	1	6
α-helix	553-555	3
α-helix	556-560	5
α-helix	561-564	4
α-helix	567-570	4
α-helix	575-578	4
α-helix	585-599	15
α-helix	618-629	12
α-helix	632-642	11
α-helix	646-648	3
α-helix	651-662	12
α-helix	668-669	2
α-helix	673-674	2
α-helix	675-678	4
α-helix	684-689	6
α-helix	706-724	19
α-helix	725-729	5
α-helix	733-743	11
α-helix	746-748	3
α-helix	780-796	17
α-helix	802-813	12
α-helix	823-824	2
α-helix	839-858	20
α-helix	860-863	4
α-helix	873-875	3
α-helix	880-883	4
α-helix	888-895	8
α-helix	898-908	11
α-helix	912-938	27
β-strand	951-952	2	9
β-strand	955-956	2	9
α-helix	957-971	15
α-helix	978-980	3
α-helix	985-992	8
β-strand	996	1	10
α-helix	1005-1013	9
β-strand	1016-1018	3	11
β-strand	1021-1022	2	11
β-strand	1027-1028	2	12
β-strand	1031-1032	2	12
α-helix	1036-1043	8
α-helix	1047-1053	7
α-helix	1055-1056	2
β-strand	1057	1	10
α-helix	1059-1072	14
α-helix	1084-1100	17
α-helix	1103-1142	40
α-helix	1150-1153	4
β-strand	1154-1157	4	5
β-strand	1163-1166	4	5
α-helix	1168-1175	8
β-strand	1184-1186	3	13
β-strand	1193-1195	3	13
α-helix	1202-1213	12
α-helix	1227-1230	4
α-helix	1233-1235	3
α-helix	1236-1247	12
α-helix	1251-1254	4
α-helix	1259-1265	7
α-helix	1266-1270	5
α-helix	1275-1278	4
α-helix	1281-1291	11
β-strand	1294-1296	3	14
β-strand	1298-1307	10	15
β-strand	1318-1327	10	15
β-strand	1333-1335	3	14
β-strand	1337-1341	5	16
β-strand	1346-1350	5	16
α-helix	1354-1365	12
α-helix	1372-1375	4
β-strand	1376	1	14

Chain C: 83 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	20-25	6	17
β-strand	30-35	6	17
β-strand	45	1	17
α-helix	48-60	13
β-strand	69	1	18
α-helix	80-93	14
α-helix	100-103	4
α-helix	106-109	4
α-helix	112-127	16
α-helix	133-135	3
α-helix	136-138	3
α-helix	143-152	10
α-helix	155-163	9
α-helix	172-182	11
β-strand	183	1	18
α-helix	185-187	3
α-helix	190-203	14
α-helix	215	1
α-helix	216-220	5
α-helix	221-227	7
α-helix	230-233	4
α-helix	236-241	6
β-strand	247-249	3	19
β-strand	255-257	3	19
α-helix	265-284	20
α-helix	289-308	20
α-helix	313-315	3
α-helix	324-332	9
β-strand	337	1	20
α-helix	340-344	5
α-helix	354-385	32
α-helix	395-413	19
α-helix	422-424	3
β-strand	425	1	20
α-helix	426-455	30
α-helix	458-460	3
β-strand	467-469	3	21
α-helix	475-477	3
α-helix	483-512	30
β-strand	515	1	22
α-helix	524-526	3
α-helix	527	1
β-strand	528	1	23
α-helix	529	1
β-strand	533	1	24
β-strand	541	1	24
β-strand	545	1	23
α-helix	546-548	3
β-strand	550	1	22
α-helix	553-555	3
α-helix	556-560	5
α-helix	561-564	4
α-helix	567-570	4
α-helix	575-578	4
α-helix	585-599	15
α-helix	618-629	12
α-helix	632-642	11
α-helix	651-662	12
α-helix	668-669	2
α-helix	673-674	2
α-helix	675-678	4
α-helix	684-689	6
α-helix	706-724	19
α-helix	725-729	5
α-helix	733-743	11
α-helix	746-748	3
α-helix	780-796	17
α-helix	802-812	11
α-helix	823-824	2
α-helix	839-858	20
α-helix	860-863	4
α-helix	873-875	3
α-helix	880-883	4
α-helix	888-895	8
α-helix	898-908	11
α-helix	912-938	27
β-strand	951-952	2	25
β-strand	955-956	2	25
α-helix	957-971	15
α-helix	978-980	3
α-helix	985-992	8
β-strand	996	1	26
α-helix	1005-1013	9
β-strand	1016-1018	3	27
β-strand	1021-1022	2	27
β-strand	1027-1028	2	28
β-strand	1031-1032	2	28
α-helix	1036-1043	8
α-helix	1047-1053	7
α-helix	1055-1056	2
β-strand	1057	1	26
α-helix	1059-1072	14
α-helix	1084-1100	17
α-helix	1103-1142	40
α-helix	1150-1153	4
β-strand	1154-1157	4	21
β-strand	1163-1166	4	21
α-helix	1168-1175	8
β-strand	1184-1186	3	29
β-strand	1193-1195	3	29
α-helix	1202-1213	12
α-helix	1227-1230	4
α-helix	1233-1235	3
α-helix	1236-1247	12
α-helix	1251-1254	4
α-helix	1259-1265	7
α-helix	1266-1270	5
α-helix	1275-1278	4
α-helix	1281-1291	11
β-strand	1294-1296	3	30
β-strand	1298-1307	10	31
β-strand	1318-1327	10	31
β-strand	1333-1335	3	30
β-strand	1337-1341	5	32
β-strand	1346-1350	5	32
α-helix	1354-1365	12
α-helix	1372-1375	4
β-strand	1376	1	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mature crRNA	B, D	RNA	52	Lachnospiraceae bacterium
LbaCas13a (C2c2)	A, C	protein	1440	Lachnospiraceae bacterium	A0A2D0TCG9

Sequence of entity 1 (B, D), FASTA

>5W1I_1 mature crRNA (chains B, D)
AAGAUAGCCCAAGAAAGAGGGCAAUAACCAGAUAUAGCCUGGUGGUUCAGGC

Sequence of entity 2 (A, C), FASTA

>5W1I_2 LbaCas13a (C2c2) (chains A, C)
SNAMKISKVREENRGAKLTVNAKTAVVSENRSQEGILYNDPSRYGKSRKNDEDRDRYIES
RLKSSGKLYRIFNEDKNKRETDELQWFLSEIVKKINRRNGLVLSDMLSVDDRAFEKAFEK
YAELSYTNRRNKVSGSPAFETCGVDAATAERLKGIISETNFINRIKNNIDNKVSEDIIDR
IIAKYLKKSLCRERVKRGLKKLLMNAFDLPYSDPDIDVQRDFIDYVLEDFYHVRAKSQVS
RSIKNMNMPVQPEGDGKFAITVSKGGTESGNKRSAEKEAFKKFLSDYASLDERVRDDMLR
RMRRLVVLYFYGSDDSKLSDVNEKFDVWEDHAARRVDNREFIKLPLENKLANGKTDKDAE
RIRKNTVKELYRNQNIGCYRQAVKAVEEDNNGRYFDDKMLNMFFIHRIEYGVEKIYANLK
QVTEFKARTGYLSEKIWKDLINYISIKYIAMGKAVYNYAMDELNASDKKEIELGKISEEY
LSGISSFDYELIKAEEMLQRETAVYVAFAARHLSSQTVELDSENSDFLLLKPKGTMDKND
KNKLASNNILNFLKDKETLRDTILQYFGGHSLWTDFPFDKYLAGGKDDVDFLTDLKDVIY
SMRNDSFHYATENHNNGKWNKELISAMFEHETERMTVVMKDKFYSNNLPMFYKNDDLKKL
LIDLYKDNVERASQVPSFNKVFVRKNFPALVRDKDNLGIELDLKADADKGENELKFYNAL
YYMFKEIYYNAFLNDKNVRERFITKATKVADNYDRNKERNLKDRIKSAGSDEKKKLREQL
QNYIAENDFGQRIKNIVQVNPDYTLAQICQLIMTEYNQQNNGCMQKKSAARKDINKDSYQ
HYKMLLLVNLRKAFLEFIKENYAFVLKPYKHDLCDKADFVPDFAKYVKPYAGLISRVAGS
SELQKWYIVSRFLSPAQANHMLGFLHSYKQYVWDIYRRASETGTEINHSIAEDKIAGVDI
TDVDAVIDLSVKLCGTISSEISDYFKDDEVYAEYISSYLDFEYDGGNYKDSLNRFCNSDA
VNDQKVALYYDGEHPKLNRNIILSKLYGERRFLEKITDRVSRSDIVEYYKLKKETSQYQT
KGIFDSEDEQKNIKKFQEMKNIVEFRDLMDYSEIADELQGQLINWIYLRERDLMNFQLGY
HYACLNNDSNKQATYVTLDYQGKKNRKINGAILYQICAMYINGLPLYYVDKDSSEWTVSD
GKESTGAKIGEFYRYAKSFENTSDCYASGLEIFENISEHDNITELRNYIEHFRYYSSFDR
SFLGIYSEVFDRFFTYDLKYRKNVPTILYNILLQHFVNVRFEFVSGKKMIGIDKKDRKIA
KEKECARITIREKNGVYSEQFTYKLKNGTVYVDARDKRYLQSIIRLLFYPEKVNMDEMIE
VKEKKKPSDNNTGKGYSKRDRQQDRKEYDKYKEKKKKEGNFLSGMGGNINWDEINAQLKN

Primary citation

Guide-bound structures of an RNA-targeting A-cleaving CRISPR-Cas13a enzyme. Knott, G.J., East-Seletsky, A., Cofsky, J.C. et al. Nat Struct Mol Biol (2017) 24:825-833. DOI 10.1038/nsmb.3466 · PubMed

Other PDB entries of the same protein (UniProt A0A2D0TCG9), best resolution first:

5W1H 1.99 Å, Crystal structure of LbaCas13a (C2c2) bound to mature crRNA (24-nt spacer)

Browse structure collections

About this viewer

MolViewer shows 5W1I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.