5W1S: Escherichia coli RNA polymerase and TraR complex

X-ray crystal structure of Escherichia coli RNA polymerase and TraR complex. Determined by X-ray diffraction at 3.81 Å resolution. Released 14 Jun 2017.

Method: X-ray diffraction
Resolution: 3.81 Å
Organism: Escherichia coli (strain K12)
Chains: 14
Atoms: 56,825
Mol. weight: 938.56 kDa
Ligands: ZN, MG
Released: 14 Jun 2017

Explore 5W1S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W1S contains 336 α-helices and 388 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	13-20	8	1
β-strand	23-28	6	1
β-strand	31	1	2
α-helix	35-48	14
β-strand	52-61	10	3
β-strand	74	1	4
α-helix	78-85	8
β-strand	90-91	2	5
β-strand	98-105	8	3
β-strand	109-111	3	6
α-helix	112-114	3
β-strand	115	1	3
β-strand	122-123	2	5
β-strand	129-132	4	6
β-strand	133	1	4
β-strand	139-150	12	3
β-strand	151-153	3	7
α-helix	155-158	4
β-strand	170-172	3	3
β-strand	175-177	3	7
β-strand	180-186	7	1
β-strand	189	1	2
β-strand	199	1	2
β-strand	202-207	6	1
α-helix	213-232	20
α-helix	251-254	4
β-strand	256	1	8
α-helix	257-260	4
α-helix	264-272	9
β-strand	277	1	8
α-helix	278-281	4
α-helix	287-290	4
α-helix	297-301	5
α-helix	303-310	8

Chain B: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	14-17	4	9
β-strand	23-31	9	9
α-helix	32	1
α-helix	35-48	14
β-strand	52-60	9	10
α-helix	78-86	9
β-strand	90-92	3	10
β-strand	99-101	3	10
β-strand	110	1	11
β-strand	121-123	3	10
β-strand	131	1	11
β-strand	143-150	8	10
β-strand	152-153	2	12
β-strand	175-176	2	12
β-strand	180-190	11	9
β-strand	198-207	10	9
α-helix	213-226	14

Chain C: 57 helices, 98 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	13
α-helix	19-20	2
α-helix	29-38	10
α-helix	49-56	8
α-helix	57	1
β-strand	59-60	2	14
β-strand	66-75	10	14
α-helix	76-78	3
α-helix	82-88	7
β-strand	93-105	13	14
β-strand	113-117	5	14
β-strand	122-128	7	14
β-strand	136-137	2	15
β-strand	142-145	4	15
β-strand	147-151	5	16
α-helix	152	1
β-strand	154-158	5	17
β-strand	173-177	5	17
β-strand	180	1	18
β-strand	184-187	4	17
β-strand	195-198	4	17
β-strand	204-205	2	17
α-helix	208-212	5
α-helix	217-224	8
β-strand	228-231	4	19
β-strand	238-240	3	19
β-strand	250	1	20
β-strand	255-257	3	21
β-strand	260-263	4	21
β-strand	268	1	20
α-helix	271-280	10
β-strand	284-286	3	19
α-helix	291-293	3
α-helix	295	1
β-strand	296-297	2	19
β-strand	301-302	2	22
β-strand	309-311	3	22
β-strand	315-316	2	19
α-helix	319-326	8
β-strand	332-335	4	19
α-helix	346-351	6
α-helix	359-370	12
α-helix	378-389	12
β-strand	396	1	18
α-helix	398-408	11
α-helix	422-437	16
β-strand	451-454	4	16
α-helix	456-481	26
α-helix	496-507	12
β-strand	509	1	15
β-strand	512-514	3	15
α-helix	520-527	8
β-strand	529	1	23
β-strand	530-531	2	16
α-helix	545-548	4
α-helix	550-551	2
α-helix	552-554	3
β-strand	558	1	24
β-strand	574	1	23
β-strand	575	1	24
β-strand	576	1	25
β-strand	580-581	2	26
β-strand	587-595	9	26
β-strand	598-607	10	26
α-helix	608-613	6
β-strand	616	1	26
β-strand	623-624	2	26
β-strand	628-629	2	26
β-strand	633-637	5	26
β-strand	642-646	5	26
β-strand	652-654	3	26
β-strand	662	1	25
α-helix	663-666	4
α-helix	671-673	3
β-strand	674	1	27
α-helix	676-685	10
α-helix	686-688	3
β-strand	689	1	28
α-helix	690-692	3
β-strand	700-701	2	13
α-helix	705-711	7
β-strand	716-717	2	29
β-strand	722-727	6	30
β-strand	731-736	6	30
β-strand	748-752	5	30
α-helix	753-754	2
β-strand	757-758	2	31
β-strand	763	1	32
β-strand	764-765	2	31
β-strand	768-769	2	29
β-strand	776-777	2	30
β-strand	782-785	4	29
β-strand	789-790	2	33
β-strand	793-794	2	33
β-strand	798-804	7	34
β-strand	816-819	4	34
α-helix	820-824	5
β-strand	830-841	12	32
β-strand	842-843	2	35
β-strand	846-847	2	35
β-strand	849	1	36
α-helix	859-862	4
β-strand	865	1	37
β-strand	870	1	38
β-strand	871	1	37
α-helix	872	1
β-strand	876-877	2	32
β-strand	882-884	3	38
β-strand	887-889	3	36
α-helix	897-906	10
β-strand	913-915	3	36
β-strand	918-919	2	38
α-helix	920-921	2
β-strand	926-935	10	32
α-helix	940-941	2
α-helix	943-979	37
α-helix	986-989	4
α-helix	994-996	3
α-helix	1006-1037	32
α-helix	1039-1041	3
β-strand	1046-1058	13	32
β-strand	1065-1068	4	34
β-strand	1073-1080	8	34
α-helix	1082-1084	3
β-strand	1087	1	39
β-strand	1093	1	39
β-strand	1096-1098	3	34
α-helix	1100-1102	3
β-strand	1108	1	27
α-helix	1110-1133	24
α-helix	1138-1148	11
α-helix	1167-1176	10
β-strand	1182-1183	2	13
α-helix	1192-1201	10
β-strand	1209-1210	2	40
β-strand	1213	1	39
α-helix	1219	1
β-strand	1220	1	39
α-helix	1221	1
β-strand	1225-1226	2	40
β-strand	1227-1234	8	34
β-strand	1235	1	28
α-helix	1239-1242	4
β-strand	1244-1246	3	41
β-strand	1250-1251	2	42
β-strand	1252	1	43
β-strand	1258-1259	2	42
α-helix	1265-1268	4
β-strand	1269	1	44
α-helix	1272-1280	9
α-helix	1284-1290	7
α-helix	1298-1310	13
α-helix	1321-1331	11
β-strand	1335	1	45
β-strand	1338-1339	2	46

Chain D: 61 helices, 61 β-strands

Element	Residues	Length	Sheet
β-strand	20-21	2	46
β-strand	24	1	45
α-helix	27-33	7
β-strand	34-37	4	47
β-strand	40	1	48
β-strand	44	1	49
α-helix	50	1
β-strand	51	1	49
α-helix	52	1
β-strand	55	1	48
β-strand	84	1	50
β-strand	91	1	50
α-helix	97-100	4
β-strand	102-112	11	47
α-helix	114-118	5
α-helix	123-127	5
α-helix	132-139	8
β-strand	144-147	4	51
β-strand	159-160	2	51
α-helix	162-171	10
β-strand	177-179	3	51
α-helix	182-191	10
α-helix	194-207	14
α-helix	211-230	20
α-helix	234-237	4
β-strand	238-244	7	47
α-helix	247-249	3
β-strand	254	1	52
α-helix	256-258	3
β-strand	260	1	52
β-strand	261-262	2	53
α-helix	264-284	21
α-helix	289-308	20
α-helix	315	1
β-strand	316	1	54
α-helix	317	1
β-strand	323	1	54
α-helix	324-325	2
α-helix	327-331	5
β-strand	346	1	44
β-strand	350-354	5	41
β-strand	355-356	2	55
β-strand	365-369	5	55
α-helix	370-376	7
α-helix	378-387	10
α-helix	394-403	10
α-helix	406-416	11
β-strand	421-425	5	41
α-helix	431-433	3
β-strand	434-437	4	41
β-strand	438-442	5	55
β-strand	447-448	2	55
α-helix	454-457	4
β-strand	465-469	5	41
α-helix	474-482	9
β-strand	485	1	41
α-helix	486-488	3
β-strand	491	1	56
β-strand	498	1	56
α-helix	505-513	9
β-strand	526-527	2	57
α-helix	530-538	9
β-strand	547-556	10	57
β-strand	558	1	58
β-strand	562	1	58
β-strand	564-573	10	57
α-helix	574-580	7
α-helix	589-592	4
α-helix	598-612	15
α-helix	614-635	22
α-helix	641-643	3
α-helix	645-647	3
α-helix	650-669	20
α-helix	675-703	29
β-strand	706	1	59
β-strand	715	1	59
α-helix	721-728	8
α-helix	734-740	7
β-strand	748	1	60
β-strand	754	1	60
α-helix	766-767	2
α-helix	769-803	35
β-strand	809	1	61
β-strand	820-822	3	62
α-helix	835-839	5
β-strand	843	1	63
β-strand	844	1	62
α-helix	847	1
β-strand	848-849	2	64
β-strand	856-858	3	64
β-strand	863	1	63
α-helix	866-874	9
β-strand	880-882	3	62
β-strand	894	1	61
α-helix	896-899	4
α-helix	908-910	3
α-helix	915-924	10
α-helix	925-929	5
α-helix	1138-1145	8
α-helix	1148-1150	3
β-strand	1156	1	65
β-strand	1161-1166	6	66
β-strand	1173-1178	6	66
β-strand	1187-1190	4	66
β-strand	1196	1	67
β-strand	1203-1204	2	66
β-strand	1209	1	65
β-strand	1211	1	67
α-helix	1217-1219	3
α-helix	1220-1224	5
α-helix	1226-1243	18
α-helix	1250-1260	11
β-strand	1263-1265	3	68
β-strand	1277-1279	3	68
α-helix	1280-1291	12
β-strand	1304-1305	2	68
α-helix	1309-1314	6
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1342	2	46
α-helix	1347-1352	6
α-helix	1360-1370	11

Chain E: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	7-12	6
α-helix	18-31	14
α-helix	46-55	10
α-helix	61-78	18
α-helix	80-83	4
α-helix	87-89	3

Chain F: 27 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	97-106	10
α-helix	109-112	4
α-helix	115-135	21
α-helix	138-152	15
α-helix	158-161	4
β-strand	162-165	4	69
α-helix	214-233	20
α-helix	245-256	12
β-strand	259-261	3	69
α-helix	263-288	26
α-helix	289-293	5
α-helix	328-331	4
α-helix	334-339	6
α-helix	342-350	9
α-helix	355-382	28
α-helix	384-391	8
α-helix	401-418	18
α-helix	421-423	3
α-helix	427-446	20
α-helix	454-473	20
α-helix	483-486	4
α-helix	493-501	9
α-helix	503-504	2
β-strand	505-506	2	53
β-strand	510	1	70
β-strand	518	1	70
α-helix	519-522	4
β-strand	524	1	43
α-helix	531-549	19
α-helix	553-562	10
α-helix	573-578	6
α-helix	585-597	13
α-helix	604-608	5

Chain G: 7 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	71
β-strand	24-31	8	71
α-helix	32	1
α-helix	35-49	15
β-strand	53-61	9	72
α-helix	78-86	9
β-strand	90-92	3	73
β-strand	97-105	9	72
β-strand	108-110	3	74
α-helix	112-114	3
β-strand	115	1	72
α-helix	116-118	3
β-strand	121-123	3	73
β-strand	131-133	3	74
β-strand	139-149	11	72
β-strand	151-153	3	75
α-helix	156-158	3
β-strand	170-172	3	72
β-strand	175-177	3	75
β-strand	180-190	11	71
β-strand	198-207	10	71
α-helix	213-227	15

Chain H: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	15-17	3	76
β-strand	23-31	9	76
α-helix	32	1
α-helix	35-48	14
β-strand	53-60	8	77
α-helix	78-86	9
β-strand	90-92	3	78
β-strand	99-103	5	77
β-strand	110-111	2	79
β-strand	115	1	77
β-strand	121-123	3	78
β-strand	129-131	3	79
β-strand	141-149	9	77
β-strand	152-153	2	80
β-strand	172	1	77
β-strand	175-176	2	80
β-strand	180-192	13	76
β-strand	195-207	13	76
α-helix	213-227	15

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	A, B, G, H	protein	329	Escherichia coli (strain K12)	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	C, I	protein	1342	Escherichia coli (strain K12)	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	D, J	protein	1407	Escherichia coli (strain K12)	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	E, K	protein	91	Escherichia coli (strain K12)	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	F, L	protein	613	Escherichia coli (strain K12)	P00579
Protein TraR	M, N	protein	79	Escherichia coli (strain K12)	P41065

Sequence of entity 1 (A, B, G, H), FASTA

>5W1S_1 DNA-directed RNA polymerase subunit alpha (chains A, B, G, H)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (C, I), FASTA

>5W1S_2 DNA-directed RNA polymerase subunit beta (chains C, I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (D, J), FASTA

>5W1S_3 DNA-directed RNA polymerase subunit beta' (chains D, J)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNE

Sequence of entity 4 (E, K), FASTA

>5W1S_4 DNA-directed RNA polymerase subunit omega (chains E, K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (F, L), FASTA

>5W1S_5 RNA polymerase sigma factor RpoD (chains F, L)
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGR
SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKK
NFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKD
INRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFE
YRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTP
EELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESL
RAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
PSRSEVLRSFLDD

Sequence of entity 6 (M, N), FASTA

>5W1S_6 Protein TraR (chains M, N)
MSDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIPEARRKIFPGVTLCVE
CQAYQERQRKHYAHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	6
MG	Magnesium ion	Mg	2

Primary citation

Allosteric Effector ppGpp Potentiates the Inhibition of Transcript Initiation by DksA. Molodtsov, V., Sineva, E., Zhang, L. et al. Mol Cell (2018) 69:828-839.e5. DOI 10.1016/j.molcel.2018.01.035 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 5W1S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.